https://launchpad.net/ubuntu/+archive/test-rebuild-20220317-jammy-gcc12/+build/23475775 RUN: /usr/share/launchpad-buildd/bin/builder-prep Kernel version: Linux riscv64-qemu-lcy01-030 5.13.0-1019-generic #21~20.04.1-Ubuntu SMP Thu Mar 24 22:36:01 UTC 2022 riscv64 Buildd toolchain package versions: launchpad-buildd_212~550~ubuntu20.04.1 python3-lpbuildd_212~550~ubuntu20.04.1 sbuild_0.79.0-1ubuntu1 git_1:2.25.1-1ubuntu3.2 dpkg-dev_1.19.7ubuntu3 python3-debian_0.1.36ubuntu1. Syncing the system clock with the buildd NTP service... 23 Apr 00:54:22 ntpdate[977871]: adjust time server 10.211.37.1 offset -0.000111 sec RUN: /usr/share/launchpad-buildd/bin/in-target unpack-chroot --backend=chroot --series=jammy --arch=riscv64 PACKAGEBUILD-23475775 --image-type chroot /home/buildd/filecache-default/03bec7884d85d5bd8bcd177f093129b6620b2195 Creating target for build PACKAGEBUILD-23475775 RUN: /usr/share/launchpad-buildd/bin/in-target mount-chroot --backend=chroot --series=jammy --arch=riscv64 PACKAGEBUILD-23475775 Starting target for build PACKAGEBUILD-23475775 RUN: /usr/share/launchpad-buildd/bin/in-target override-sources-list --backend=chroot --series=jammy --arch=riscv64 PACKAGEBUILD-23475775 'deb http://ppa.launchpadcontent.net/ubuntu-toolchain-r/volatile/ubuntu jammy main' 'deb http://ftpmaster.internal/ubuntu jammy main universe' Overriding sources.list in build-PACKAGEBUILD-23475775 RUN: /usr/share/launchpad-buildd/bin/in-target add-trusted-keys --backend=chroot --series=jammy --arch=riscv64 PACKAGEBUILD-23475775 Adding trusted keys to build-PACKAGEBUILD-23475775 Warning: apt-key is deprecated. Manage keyring files in trusted.gpg.d instead (see apt-key(8)). OK Warning: apt-key is deprecated. Manage keyring files in trusted.gpg.d instead (see apt-key(8)). /etc/apt/trusted.gpg -------------------- pub rsa1024 2009-10-22 [SC] 60C3 1780 3A41 BA51 845E 371A 1E93 77A2 BA9E F27F uid [ unknown] Launchpad Toolchain builds /etc/apt/trusted.gpg.d/ubuntu-keyring-2012-cdimage.gpg ------------------------------------------------------ pub rsa4096 2012-05-11 [SC] 8439 38DF 228D 22F7 B374 2BC0 D94A A3F0 EFE2 1092 uid [ unknown] Ubuntu CD Image Automatic Signing Key (2012) /etc/apt/trusted.gpg.d/ubuntu-keyring-2018-archive.gpg ------------------------------------------------------ pub rsa4096 2018-09-17 [SC] F6EC B376 2474 EDA9 D21B 7022 8719 20D1 991B C93C uid [ unknown] Ubuntu Archive Automatic Signing Key (2018) RUN: /usr/share/launchpad-buildd/bin/in-target update-debian-chroot --backend=chroot --series=jammy --arch=riscv64 PACKAGEBUILD-23475775 Updating target for build PACKAGEBUILD-23475775 Get:1 http://ppa.launchpadcontent.net/ubuntu-toolchain-r/volatile/ubuntu jammy InRelease [23.8 kB] Get:2 http://ftpmaster.internal/ubuntu jammy InRelease [270 kB] Get:3 http://ppa.launchpadcontent.net/ubuntu-toolchain-r/volatile/ubuntu jammy/main riscv64 Packages [3840 B] Get:4 http://ppa.launchpadcontent.net/ubuntu-toolchain-r/volatile/ubuntu jammy/main Translation-en [5972 B] Get:5 http://ftpmaster.internal/ubuntu jammy/main riscv64 Packages [1287 kB] Get:6 http://ftpmaster.internal/ubuntu jammy/main Translation-en [510 kB] Get:7 http://ftpmaster.internal/ubuntu jammy/universe riscv64 Packages [12.9 MB] Get:8 http://ftpmaster.internal/ubuntu jammy/universe Translation-en [5652 kB] Fetched 20.7 MB in 34s (608 kB/s) Reading package lists... Reading package lists... Building dependency tree... Reading state information... Calculating upgrade... The following packages were automatically installed and are no longer required: g++-11 libperl5.32 libstdc++-11-dev perl-modules-5.32 Use 'sudo apt autoremove' to remove them. The following packages will be REMOVED: libsemanage1* The following NEW packages will be installed: cpp-12 g++-12 gcc-12 gcc-12-base libasan8 libexpat1 libgcc-12-dev libmpdec3 libperl5.34 libpython3-stdlib libpython3.10-minimal libpython3.10-stdlib libsemanage2 libsepol2 libssl3 libstdc++-12-dev media-types perl-modules-5.34 python3 python3-minimal python3-psutil python3.10 python3.10-minimal The following packages will be upgraded: advancecomp apt base-files base-passwd bash binutils binutils-common binutils-riscv64-linux-gnu bsdutils build-essential bzip2 ca-certificates coreutils cpp cpp-11 dash debconf debianutils diffutils dpkg dpkg-dev e2fsprogs fakeroot findutils g++ g++-11 gcc gcc-11 gcc-11-base gpg gpg-agent gpgconf gpgv grep gzip hostname init init-system-helpers libacl1 libapparmor1 libapt-pkg6.0 libargon2-1 libasan6 libassuan0 libatomic1 libattr1 libaudit-common libaudit1 libbinutils libblkid1 libbz2-1.0 libc-bin libc-dev-bin libc6 libc6-dev libcap-ng0 libcap2 libcc1-0 libcom-err2 libcrypt-dev libcrypt1 libcryptsetup12 libctf-nobfd0 libctf0 libdb5.3 libdebconfclient0 libdevmapper1.02.1 libdpkg-perl libext2fs2 libfakeroot libffi8 libgcc-11-dev libgcc-s1 libgcrypt20 libgdbm-compat4 libgdbm6 libgmp10 libgnutls30 libgomp1 libgpg-error0 libgssapi-krb5-2 libhogweed6 libidn2-0 libip4tc2 libisl23 libjson-c5 libk5crypto3 libkeyutils1 libkmod2 libkrb5-3 libkrb5support0 liblockfile-bin liblockfile1 liblz4-1 liblzma5 libmount1 libmpc3 libmpfr6 libncurses6 libncursesw6 libnettle8 libnpth0 libnsl-dev libnsl2 libp11-kit0 libpam-modules libpam-modules-bin libpam-runtime libpam0g libpcre2-8-0 libpcre3 libpng16-16 libprocps8 libreadline8 libseccomp2 libselinux1 libsemanage-common libsmartcols1 libsqlite3-0 libss2 libstdc++-11-dev libstdc++6 libsystemd0 libtasn1-6 libtinfo6 libtirpc-common libtirpc-dev libtirpc3 libudev1 libunistring2 libuuid1 libxxhash0 libzstd1 linux-libc-dev lockfile-progs login logsave lsb-base lto-disabled-list make mawk mount ncurses-base ncurses-bin openssl optipng passwd patch perl perl-base pinentry-curses pkgbinarymangler procps readline-common rpcsvc-proto sed sensible-utils systemd systemd-sysv systemd-timesyncd sysvinit-utils tar tzdata usrmerge util-linux xz-utils zlib1g 167 upgraded, 23 newly installed, 1 to remove and 0 not upgraded. Need to get 143 MB of archives. After this operation, 229 MB of additional disk space will be used. Get:1 http://ftpmaster.internal/ubuntu jammy/main riscv64 rpcsvc-proto riscv64 1.4.2-0ubuntu6 [62.2 kB] Get:2 http://ftpmaster.internal/ubuntu jammy/main riscv64 libnsl-dev riscv64 1.3.0-2build2 [125 kB] Get:3 http://ppa.launchpadcontent.net/ubuntu-toolchain-r/volatile/ubuntu jammy/main riscv64 dpkg riscv64 1.21.1ubuntu11 [1212 kB] Get:4 http://ftpmaster.internal/ubuntu jammy/main riscv64 libcrypt-dev riscv64 1:4.4.27-1 [249 kB] Get:5 http://ftpmaster.internal/ubuntu jammy/main riscv64 libc6-dev riscv64 2.35-0ubuntu3 [3236 kB] Get:6 http://ppa.launchpadcontent.net/ubuntu-toolchain-r/volatile/ubuntu jammy/main riscv64 g++ riscv64 4:12-20211211-1ubuntu2 [1402 B] Get:7 http://ppa.launchpadcontent.net/ubuntu-toolchain-r/volatile/ubuntu jammy/main riscv64 gcc riscv64 4:12-20211211-1ubuntu2 [5138 B] Get:8 http://ppa.launchpadcontent.net/ubuntu-toolchain-r/volatile/ubuntu jammy/main riscv64 cpp riscv64 4:12-20211211-1ubuntu2 [27.7 kB] Get:9 http://ppa.launchpadcontent.net/ubuntu-toolchain-r/volatile/ubuntu jammy/main riscv64 dpkg-dev all 1.21.1ubuntu11 [926 kB] Get:10 http://ppa.launchpadcontent.net/ubuntu-toolchain-r/volatile/ubuntu jammy/main riscv64 libdpkg-perl all 1.21.1ubuntu11 [236 kB] Get:11 http://ftpmaster.internal/ubuntu jammy/main riscv64 libc-dev-bin riscv64 2.35-0ubuntu3 [18.9 kB] Get:12 http://ftpmaster.internal/ubuntu jammy/main riscv64 libtirpc-common all 1.3.2-2build1 [7616 B] Get:13 http://ftpmaster.internal/ubuntu jammy/main riscv64 libtirpc-dev riscv64 1.3.2-2build1 [310 kB] Get:14 http://ftpmaster.internal/ubuntu jammy/main riscv64 libssl3 riscv64 3.0.2-0ubuntu1 [1454 kB] Get:15 http://ftpmaster.internal/ubuntu jammy/main riscv64 libk5crypto3 riscv64 1.19.2-2 [102 kB] Get:16 http://ftpmaster.internal/ubuntu jammy/main riscv64 libkrb5support0 riscv64 1.19.2-2 [30.7 kB] Get:17 http://ftpmaster.internal/ubuntu jammy/main riscv64 libkrb5-3 riscv64 1.19.2-2 [337 kB] Get:18 http://ftpmaster.internal/ubuntu jammy/main riscv64 libgssapi-krb5-2 riscv64 1.19.2-2 [127 kB] Get:19 http://ftpmaster.internal/ubuntu jammy/main riscv64 perl-modules-5.34 all 5.34.0-3ubuntu1 [2975 kB] Get:20 http://ftpmaster.internal/ubuntu jammy/main riscv64 libperl5.34 riscv64 5.34.0-3ubuntu1 [4206 kB] Get:21 http://ftpmaster.internal/ubuntu jammy/main riscv64 perl riscv64 5.34.0-3ubuntu1 [232 kB] Get:22 http://ftpmaster.internal/ubuntu jammy/main riscv64 perl-base riscv64 5.34.0-3ubuntu1 [1639 kB] Get:23 http://ftpmaster.internal/ubuntu jammy/main riscv64 bzip2 riscv64 1.0.8-5build1 [34.0 kB] Get:24 http://ftpmaster.internal/ubuntu jammy/main riscv64 libbz2-1.0 riscv64 1.0.8-5build1 [36.3 kB] Get:25 http://ftpmaster.internal/ubuntu jammy/main riscv64 libaudit-common all 1:3.0.7-1build1 [4726 B] Get:26 http://ftpmaster.internal/ubuntu jammy/main riscv64 libcap-ng0 riscv64 0.7.9-2.2build3 [10.3 kB] Get:27 http://ftpmaster.internal/ubuntu jammy/main riscv64 libaudit1 riscv64 1:3.0.7-1build1 [45.4 kB] Get:28 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpam0g riscv64 1.4.0-11ubuntu2 [56.2 kB] Get:29 http://ftpmaster.internal/ubuntu jammy/main riscv64 libcrypt1 riscv64 1:4.4.27-1 [97.4 kB] Get:30 http://ftpmaster.internal/ubuntu jammy/main riscv64 libdb5.3 riscv64 5.3.28+dfsg1-0.8ubuntu3 [667 kB] Get:31 http://ftpmaster.internal/ubuntu jammy/main riscv64 libgdbm6 riscv64 1.23-1 [29.9 kB] Get:32 http://ftpmaster.internal/ubuntu jammy/main riscv64 libgdbm-compat4 riscv64 1.23-1 [5860 B] Get:33 http://ftpmaster.internal/ubuntu jammy/main riscv64 zlib1g riscv64 1:1.2.11.dfsg-2ubuntu9 [55.9 kB] Get:34 http://ftpmaster.internal/ubuntu jammy/main riscv64 debconf all 1.5.79ubuntu1 [126 kB] Get:35 http://ftpmaster.internal/ubuntu jammy/main riscv64 libcom-err2 riscv64 1.46.5-2ubuntu1 [8838 B] Get:36 http://ftpmaster.internal/ubuntu jammy/main riscv64 libkeyutils1 riscv64 1.6.1-2ubuntu3 [9204 B] Get:37 http://ftpmaster.internal/ubuntu jammy/main riscv64 libtirpc3 riscv64 1.3.2-2build1 [74.2 kB] Get:38 http://ftpmaster.internal/ubuntu jammy/main riscv64 libnsl2 riscv64 1.3.0-2build2 [37.5 kB] Get:39 http://ftpmaster.internal/ubuntu jammy/main riscv64 linux-libc-dev riscv64 5.15.0-25.25 [1262 kB] Get:40 http://ftpmaster.internal/ubuntu jammy/main riscv64 libc6 riscv64 2.35-0ubuntu3 [2640 kB] Get:41 http://ftpmaster.internal/ubuntu jammy/main riscv64 libc-bin riscv64 2.35-0ubuntu3 [561 kB] Get:42 http://ftpmaster.internal/ubuntu jammy/main riscv64 gcc-12-base riscv64 12-20220319-1ubuntu1 [18.9 kB] Get:43 http://ftpmaster.internal/ubuntu jammy/main riscv64 libgcc-s1 riscv64 12-20220319-1ubuntu1 [44.2 kB] Get:44 http://ftpmaster.internal/ubuntu jammy/main riscv64 base-files riscv64 12ubuntu4 [62.6 kB] Get:45 http://ftpmaster.internal/ubuntu jammy/main riscv64 debianutils riscv64 5.5-1ubuntu2 [106 kB] Get:46 http://ftpmaster.internal/ubuntu jammy/main riscv64 bash riscv64 5.1-6ubuntu1 [647 kB] Get:47 http://ftpmaster.internal/ubuntu jammy/main riscv64 bsdutils riscv64 1:2.37.2-4ubuntu3 [91.4 kB] Get:48 http://ftpmaster.internal/ubuntu jammy/main riscv64 coreutils riscv64 8.32-4.1ubuntu1 [1318 kB] Get:49 http://ftpmaster.internal/ubuntu jammy/main riscv64 libgpg-error0 riscv64 1.43-3 [63.8 kB] Get:50 http://ftpmaster.internal/ubuntu jammy/main riscv64 libgcrypt20 riscv64 1.9.4-3ubuntu3 [498 kB] Get:51 http://ftpmaster.internal/ubuntu jammy/main riscv64 liblz4-1 riscv64 1.9.3-2build2 [71.0 kB] Get:52 http://ftpmaster.internal/ubuntu jammy/main riscv64 liblzma5 riscv64 5.2.5-2ubuntu1 [94.1 kB] Get:53 http://ftpmaster.internal/ubuntu jammy/main riscv64 libstdc++6 riscv64 12-20220319-1ubuntu1 [687 kB] Get:54 http://ftpmaster.internal/ubuntu jammy/main riscv64 libargon2-1 riscv64 0~20171227-0.3 [19.7 kB] Get:55 http://ftpmaster.internal/ubuntu jammy/main riscv64 libblkid1 riscv64 2.37.2-4ubuntu3 [149 kB] Get:56 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpcre2-8-0 riscv64 10.39-3build1 [136 kB] Get:57 http://ftpmaster.internal/ubuntu jammy/main riscv64 libselinux1 riscv64 3.3-1build2 [71.1 kB] Get:58 http://ftpmaster.internal/ubuntu jammy/main riscv64 libudev1 riscv64 249.11-0ubuntu3 [70.1 kB] Get:59 http://ftpmaster.internal/ubuntu jammy/main riscv64 libdevmapper1.02.1 riscv64 2:1.02.175-2.1ubuntu4 [131 kB] Get:60 http://ftpmaster.internal/ubuntu jammy/main riscv64 libjson-c5 riscv64 0.15-2build4 [28.8 kB] Get:61 http://ftpmaster.internal/ubuntu jammy/main riscv64 libuuid1 riscv64 2.37.2-4ubuntu3 [27.3 kB] Get:62 http://ftpmaster.internal/ubuntu jammy/main riscv64 libcryptsetup12 riscv64 2:2.4.3-1ubuntu1 [184 kB] Get:63 http://ftpmaster.internal/ubuntu jammy/main riscv64 libgmp10 riscv64 2:6.2.1+dfsg-3ubuntu1 [245 kB] Get:64 http://ftpmaster.internal/ubuntu jammy/main riscv64 libnettle8 riscv64 3.7.3-1build2 [189 kB] Get:65 http://ftpmaster.internal/ubuntu jammy/main riscv64 libhogweed6 riscv64 3.7.3-1build2 [192 kB] Get:66 http://ftpmaster.internal/ubuntu jammy/main riscv64 libunistring2 riscv64 1.0-1 [540 kB] Get:67 http://ftpmaster.internal/ubuntu jammy/main riscv64 libidn2-0 riscv64 2.3.2-2build1 [67.4 kB] Get:68 http://ftpmaster.internal/ubuntu jammy/main riscv64 libffi8 riscv64 3.4.2-4 [20.4 kB] Get:69 http://ftpmaster.internal/ubuntu jammy/main riscv64 libp11-kit0 riscv64 0.24.0-6build1 [200 kB] Get:70 http://ftpmaster.internal/ubuntu jammy/main riscv64 libtasn1-6 riscv64 4.18.0-4build1 [39.0 kB] Get:71 http://ftpmaster.internal/ubuntu jammy/main riscv64 libgnutls30 riscv64 3.7.3-4ubuntu1 [870 kB] Get:72 http://ftpmaster.internal/ubuntu jammy/main riscv64 systemd-sysv riscv64 249.11-0ubuntu3 [10.5 kB] Get:73 http://ftpmaster.internal/ubuntu jammy/main riscv64 systemd-timesyncd riscv64 249.11-0ubuntu3 [28.9 kB] Get:74 http://ftpmaster.internal/ubuntu jammy/main riscv64 libacl1 riscv64 2.3.1-1 [15.3 kB] Get:75 http://ftpmaster.internal/ubuntu jammy/main riscv64 libapparmor1 riscv64 3.0.4-2ubuntu2 [34.2 kB] Get:76 http://ftpmaster.internal/ubuntu jammy/main riscv64 libip4tc2 riscv64 1.8.7-1ubuntu5 [18.2 kB] Get:77 http://ftpmaster.internal/ubuntu jammy/main riscv64 libzstd1 riscv64 1.4.8+dfsg-3build1 [370 kB] Get:78 http://ftpmaster.internal/ubuntu jammy/main riscv64 libkmod2 riscv64 29-1ubuntu1 [42.1 kB] Get:79 http://ftpmaster.internal/ubuntu jammy/main riscv64 libmount1 riscv64 2.37.2-4ubuntu3 [157 kB] Get:80 http://ftpmaster.internal/ubuntu jammy/main riscv64 libseccomp2 riscv64 2.5.3-2ubuntu2 [45.1 kB] Get:81 http://ftpmaster.internal/ubuntu jammy/main riscv64 login riscv64 1:4.8.1-2ubuntu2 [184 kB] Get:82 http://ftpmaster.internal/ubuntu jammy/main riscv64 util-linux riscv64 2.37.2-4ubuntu3 [1124 kB] Get:83 http://ftpmaster.internal/ubuntu jammy/main riscv64 mount riscv64 2.37.2-4ubuntu3 [129 kB] Get:84 http://ftpmaster.internal/ubuntu jammy/main riscv64 systemd riscv64 249.11-0ubuntu3 [4145 kB] Get:85 http://ftpmaster.internal/ubuntu jammy/main riscv64 libsystemd0 riscv64 249.11-0ubuntu3 [291 kB] Get:86 http://ftpmaster.internal/ubuntu jammy/main riscv64 libxxhash0 riscv64 0.8.1-1 [31.9 kB] Get:87 http://ftpmaster.internal/ubuntu jammy/main riscv64 libapt-pkg6.0 riscv64 2.4.5 [916 kB] Get:88 http://ftpmaster.internal/ubuntu jammy/main riscv64 tar riscv64 1.34+dfsg-1build3 [274 kB] Get:89 http://ftpmaster.internal/ubuntu jammy/main riscv64 dash riscv64 0.5.11+git20210903+057cd650a4ed-3build1 [86.7 kB] Get:90 http://ftpmaster.internal/ubuntu jammy/main riscv64 diffutils riscv64 1:3.8-0ubuntu2 [164 kB] Get:91 http://ftpmaster.internal/ubuntu jammy/main riscv64 findutils riscv64 4.8.0-1ubuntu3 [328 kB] Get:92 http://ftpmaster.internal/ubuntu jammy/main riscv64 grep riscv64 3.7-1build1 [151 kB] Get:93 http://ftpmaster.internal/ubuntu jammy/main riscv64 gzip riscv64 1.10-4ubuntu4 [95.4 kB] Get:94 http://ftpmaster.internal/ubuntu jammy/main riscv64 hostname riscv64 3.23ubuntu2 [10.9 kB] Get:95 http://ftpmaster.internal/ubuntu jammy/main riscv64 libncurses6 riscv64 6.3-2 [93.6 kB] Get:96 http://ftpmaster.internal/ubuntu jammy/main riscv64 libncursesw6 riscv64 6.3-2 [128 kB] Get:97 http://ftpmaster.internal/ubuntu jammy/main riscv64 libtinfo6 riscv64 6.3-2 [96.1 kB] Get:98 http://ftpmaster.internal/ubuntu jammy/main riscv64 ncurses-bin riscv64 6.3-2 [176 kB] Get:99 http://ftpmaster.internal/ubuntu jammy/main riscv64 sed riscv64 4.8-1ubuntu2 [187 kB] Get:100 http://ftpmaster.internal/ubuntu jammy/main riscv64 libdebconfclient0 riscv64 0.261ubuntu1 [6560 B] Get:101 http://ftpmaster.internal/ubuntu jammy/main riscv64 base-passwd riscv64 3.5.52build1 [49.1 kB] Get:102 http://ftpmaster.internal/ubuntu jammy/main riscv64 init-system-helpers all 1.62 [38.5 kB] Get:103 http://ftpmaster.internal/ubuntu jammy/main riscv64 ncurses-base all 6.3-2 [20.1 kB] Get:104 http://ftpmaster.internal/ubuntu jammy/main riscv64 lsb-base all 11.1.0ubuntu4 [12.3 kB] Get:105 http://ftpmaster.internal/ubuntu jammy/main riscv64 sysvinit-utils riscv64 3.01-1ubuntu1 [20.8 kB] Get:106 http://ftpmaster.internal/ubuntu jammy/main riscv64 gpgv riscv64 2.2.27-3ubuntu2 [195 kB] Get:107 http://ftpmaster.internal/ubuntu jammy/main riscv64 apt riscv64 2.4.5 [1340 kB] Get:108 http://ftpmaster.internal/ubuntu jammy/main riscv64 libsepol2 riscv64 3.3-1build1 [254 kB] Get:109 http://ftpmaster.internal/ubuntu jammy/main riscv64 libsemanage-common all 3.3-1build2 [9874 B] Get:110 http://ftpmaster.internal/ubuntu jammy/main riscv64 libsemanage2 riscv64 3.3-1build2 [83.9 kB] Get:111 http://ftpmaster.internal/ubuntu jammy/main riscv64 passwd riscv64 1:4.8.1-2ubuntu2 [736 kB] Get:112 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpam-modules-bin riscv64 1.4.0-11ubuntu2 [36.9 kB] Get:113 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpam-modules riscv64 1.4.0-11ubuntu2 [264 kB] Get:114 http://ftpmaster.internal/ubuntu jammy/main riscv64 logsave riscv64 1.46.5-2ubuntu1 [10.1 kB] Get:115 http://ftpmaster.internal/ubuntu jammy/main riscv64 libext2fs2 riscv64 1.46.5-2ubuntu1 [196 kB] Get:116 http://ftpmaster.internal/ubuntu jammy/main riscv64 e2fsprogs riscv64 1.46.5-2ubuntu1 [554 kB] Get:117 http://ftpmaster.internal/ubuntu jammy/main riscv64 init riscv64 1.62 [5414 B] Get:118 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpython3.10-minimal riscv64 3.10.4-3 [793 kB] Get:119 http://ftpmaster.internal/ubuntu jammy/main riscv64 libexpat1 riscv64 2.4.7-1 [85.2 kB] Get:120 http://ftpmaster.internal/ubuntu jammy/main riscv64 python3.10-minimal riscv64 3.10.4-3 [1817 kB] Get:121 http://ftpmaster.internal/ubuntu jammy/main riscv64 python3-minimal riscv64 3.10.4-0ubuntu2 [24.4 kB] Get:122 http://ftpmaster.internal/ubuntu jammy/main riscv64 media-types all 7.0.0 [25.5 kB] Get:123 http://ftpmaster.internal/ubuntu jammy/main riscv64 libmpdec3 riscv64 2.5.1-2build2 [85.3 kB] Get:124 http://ftpmaster.internal/ubuntu jammy/main riscv64 readline-common all 8.1.2-1 [53.5 kB] Get:125 http://ftpmaster.internal/ubuntu jammy/main riscv64 libreadline8 riscv64 8.1.2-1 [130 kB] Get:126 http://ftpmaster.internal/ubuntu jammy/main riscv64 libsqlite3-0 riscv64 3.37.2-2 [559 kB] Get:127 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpython3.10-stdlib riscv64 3.10.4-3 [1717 kB] Get:128 http://ftpmaster.internal/ubuntu jammy/main riscv64 python3.10 riscv64 3.10.4-3 [488 kB] Get:129 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpython3-stdlib riscv64 3.10.4-0ubuntu2 [6988 B] Get:130 http://ftpmaster.internal/ubuntu jammy/main riscv64 python3 riscv64 3.10.4-0ubuntu2 [22.8 kB] Get:131 http://ftpmaster.internal/ubuntu jammy/main riscv64 libattr1 riscv64 1:2.5.1-1build1 [12.6 kB] Get:132 http://ftpmaster.internal/ubuntu jammy/main riscv64 libcap2 riscv64 1:2.44-1build3 [16.3 kB] Get:133 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpam-runtime all 1.4.0-11ubuntu2 [40.3 kB] Get:134 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpcre3 riscv64 2:8.39-13build5 [171 kB] Get:135 http://ftpmaster.internal/ubuntu jammy/main riscv64 libsmartcols1 riscv64 2.37.2-4ubuntu3 [103 kB] Get:136 http://ftpmaster.internal/ubuntu jammy/main riscv64 libprocps8 riscv64 2:3.3.17-6ubuntu2 [32.7 kB] Get:137 http://ftpmaster.internal/ubuntu jammy/main riscv64 libss2 riscv64 1.46.5-2ubuntu1 [10.7 kB] Get:138 http://ftpmaster.internal/ubuntu jammy/main riscv64 mawk riscv64 1.3.4.20200120-3 [95.0 kB] Get:139 http://ftpmaster.internal/ubuntu jammy/main riscv64 procps riscv64 2:3.3.17-6ubuntu2 [372 kB] Get:140 http://ftpmaster.internal/ubuntu jammy/main riscv64 sensible-utils all 0.0.17 [20.1 kB] Get:141 http://ftpmaster.internal/ubuntu jammy/main riscv64 usrmerge all 25ubuntu2 [54.7 kB] Get:142 http://ftpmaster.internal/ubuntu jammy/main riscv64 openssl riscv64 3.0.2-0ubuntu1 [1144 kB] Get:143 http://ftpmaster.internal/ubuntu jammy/main riscv64 ca-certificates all 20211016 [148 kB] Get:144 http://ftpmaster.internal/ubuntu jammy/main riscv64 tzdata all 2022a-0ubuntu1 [342 kB] Get:145 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpng16-16 riscv64 1.6.37-3build5 [178 kB] Get:146 http://ftpmaster.internal/ubuntu jammy/main riscv64 xz-utils riscv64 5.2.5-2ubuntu1 [81.4 kB] Get:147 http://ftpmaster.internal/ubuntu jammy/main riscv64 advancecomp riscv64 2.1-2.1ubuntu2 [209 kB] Get:148 http://ftpmaster.internal/ubuntu jammy/main riscv64 libctf0 riscv64 2.38-3ubuntu1 [97.9 kB] Get:149 http://ftpmaster.internal/ubuntu jammy/main riscv64 libctf-nobfd0 riscv64 2.38-3ubuntu1 [99.7 kB] Get:150 http://ftpmaster.internal/ubuntu jammy/main riscv64 binutils-riscv64-linux-gnu riscv64 2.38-3ubuntu1 [927 kB] Get:151 http://ftpmaster.internal/ubuntu jammy/main riscv64 libbinutils riscv64 2.38-3ubuntu1 [492 kB] Get:152 http://ftpmaster.internal/ubuntu jammy/main riscv64 binutils riscv64 2.38-3ubuntu1 [3096 B] Get:153 http://ftpmaster.internal/ubuntu jammy/main riscv64 binutils-common riscv64 2.38-3ubuntu1 [213 kB] Get:154 http://ftpmaster.internal/ubuntu jammy/main riscv64 libisl23 riscv64 0.24-2build1 [593 kB] Get:155 http://ftpmaster.internal/ubuntu jammy/main riscv64 libmpfr6 riscv64 4.1.0-3build3 [252 kB] Get:156 http://ftpmaster.internal/ubuntu jammy/main riscv64 libmpc3 riscv64 1.2.1-2build1 [44.5 kB] Get:157 http://ftpmaster.internal/ubuntu jammy/universe riscv64 cpp-12 riscv64 12-20220319-1ubuntu1 [8299 kB] Get:158 http://ftpmaster.internal/ubuntu jammy/main riscv64 libcc1-0 riscv64 12-20220319-1ubuntu1 [43.6 kB] Get:159 http://ftpmaster.internal/ubuntu jammy/main riscv64 libgomp1 riscv64 12-20220319-1ubuntu1 [111 kB] Get:160 http://ftpmaster.internal/ubuntu jammy/main riscv64 libatomic1 riscv64 12-20220319-1ubuntu1 [7862 B] Get:161 http://ftpmaster.internal/ubuntu jammy/main riscv64 libasan8 riscv64 12-20220319-1ubuntu1 [2324 kB] Get:162 http://ftpmaster.internal/ubuntu jammy/main riscv64 libgcc-12-dev riscv64 12-20220319-1ubuntu1 [2630 kB] Get:163 http://ftpmaster.internal/ubuntu jammy/universe riscv64 gcc-12 riscv64 12-20220319-1ubuntu1 [16.3 MB] Get:164 http://ftpmaster.internal/ubuntu jammy/universe riscv64 libstdc++-12-dev riscv64 12-20220319-1ubuntu1 [4994 kB] Get:165 http://ftpmaster.internal/ubuntu jammy/universe riscv64 g++-12 riscv64 12-20220319-1ubuntu1 [9559 kB] Get:166 http://ftpmaster.internal/ubuntu jammy/main riscv64 make riscv64 4.3-4.1build1 [165 kB] Get:167 http://ftpmaster.internal/ubuntu jammy/main riscv64 patch riscv64 2.7.6-7build2 [103 kB] Get:168 http://ftpmaster.internal/ubuntu jammy/main riscv64 lto-disabled-list all 24 [12.5 kB] Get:169 http://ftpmaster.internal/ubuntu jammy/main riscv64 python3-psutil riscv64 5.9.0-1build1 [156 kB] Get:170 http://ftpmaster.internal/ubuntu jammy/main riscv64 build-essential riscv64 12.9ubuntu3 [4752 B] Get:171 http://ftpmaster.internal/ubuntu jammy/main riscv64 libasan6 riscv64 11.2.0-19ubuntu1 [2106 kB] Get:172 http://ftpmaster.internal/ubuntu jammy/main riscv64 g++-11 riscv64 11.2.0-19ubuntu1 [9292 kB] Get:173 http://ftpmaster.internal/ubuntu jammy/main riscv64 gcc-11 riscv64 11.2.0-19ubuntu1 [15.9 MB] Get:174 http://ftpmaster.internal/ubuntu jammy/main riscv64 libstdc++-11-dev riscv64 11.2.0-19ubuntu1 [4748 kB] Get:175 http://ftpmaster.internal/ubuntu jammy/main riscv64 libgcc-11-dev riscv64 11.2.0-19ubuntu1 [2395 kB] Get:176 http://ftpmaster.internal/ubuntu jammy/main riscv64 cpp-11 riscv64 11.2.0-19ubuntu1 [7987 kB] Get:177 http://ftpmaster.internal/ubuntu jammy/main riscv64 gcc-11-base riscv64 11.2.0-19ubuntu1 [20.8 kB] Get:178 http://ftpmaster.internal/ubuntu jammy/main riscv64 libfakeroot riscv64 1.28-1ubuntu1 [28.0 kB] Get:179 http://ftpmaster.internal/ubuntu jammy/main riscv64 fakeroot riscv64 1.28-1ubuntu1 [68.1 kB] Get:180 http://ftpmaster.internal/ubuntu jammy/main riscv64 libassuan0 riscv64 2.5.5-1build1 [33.0 kB] Get:181 http://ftpmaster.internal/ubuntu jammy/main riscv64 pinentry-curses riscv64 1.1.1-1build2 [35.9 kB] Get:182 http://ftpmaster.internal/ubuntu jammy/main riscv64 libnpth0 riscv64 1.6-3build2 [7340 B] Get:183 http://ftpmaster.internal/ubuntu jammy/main riscv64 gpg riscv64 2.2.27-3ubuntu2 [488 kB] Get:184 http://ftpmaster.internal/ubuntu jammy/main riscv64 gpgconf riscv64 2.2.27-3ubuntu2 [116 kB] Get:185 http://ftpmaster.internal/ubuntu jammy/main riscv64 gpg-agent riscv64 2.2.27-3ubuntu2 [231 kB] Get:186 http://ftpmaster.internal/ubuntu jammy/main riscv64 liblockfile-bin riscv64 1.17-1build2 [11.3 kB] Get:187 http://ftpmaster.internal/ubuntu jammy/main riscv64 liblockfile1 riscv64 1.17-1build2 [5986 B] Get:188 http://ftpmaster.internal/ubuntu jammy/main riscv64 lockfile-progs riscv64 0.1.19build1 [9384 B] Get:189 http://ftpmaster.internal/ubuntu jammy/main riscv64 optipng riscv64 0.7.7-2build1 [84.6 kB] Get:190 http://ftpmaster.internal/ubuntu jammy/main riscv64 pkgbinarymangler all 149 [32.4 kB] debconf: delaying package configuration, since apt-utils is not installed Fetched 143 MB in 33s (4381 kB/s) (Reading database ... 13170 files and directories currently installed.) Preparing to unpack .../0-rpcsvc-proto_1.4.2-0ubuntu6_riscv64.deb ... Unpacking rpcsvc-proto (1.4.2-0ubuntu6) over (1.4.2-0ubuntu5) ... Preparing to unpack .../1-libnsl-dev_1.3.0-2build2_riscv64.deb ... Unpacking libnsl-dev:riscv64 (1.3.0-2build2) over (1.3.0-2build1) ... Preparing to unpack .../2-libcrypt-dev_1%3a4.4.27-1_riscv64.deb ... Unpacking libcrypt-dev:riscv64 (1:4.4.27-1) over (1:4.4.18-4ubuntu2) ... Preparing to unpack .../3-libc6-dev_2.35-0ubuntu3_riscv64.deb ... Unpacking libc6-dev:riscv64 (2.35-0ubuntu3) over (2.34-0ubuntu3) ... Preparing to unpack .../4-libc-dev-bin_2.35-0ubuntu3_riscv64.deb ... Unpacking libc-dev-bin (2.35-0ubuntu3) over (2.34-0ubuntu3) ... Preparing to unpack .../5-libtirpc-common_1.3.2-2build1_all.deb ... Unpacking libtirpc-common (1.3.2-2build1) over (1.3.2-2) ... Setting up libtirpc-common (1.3.2-2build1) ... (Reading database ... 13175 files and directories currently installed.) Preparing to unpack .../libtirpc-dev_1.3.2-2build1_riscv64.deb ... Unpacking libtirpc-dev:riscv64 (1.3.2-2build1) over (1.3.2-2) ... Selecting previously unselected package libssl3:riscv64. Preparing to unpack .../libssl3_3.0.2-0ubuntu1_riscv64.deb ... Unpacking libssl3:riscv64 (3.0.2-0ubuntu1) ... Setting up libssl3:riscv64 (3.0.2-0ubuntu1) ... (Reading database ... 13186 files and directories currently installed.) Preparing to unpack .../libk5crypto3_1.19.2-2_riscv64.deb ... Unpacking libk5crypto3:riscv64 (1.19.2-2) over (1.18.3-6) ... Setting up libk5crypto3:riscv64 (1.19.2-2) ... (Reading database ... 13186 files and directories currently installed.) Preparing to unpack .../libkrb5support0_1.19.2-2_riscv64.deb ... Unpacking libkrb5support0:riscv64 (1.19.2-2) over (1.18.3-6) ... Setting up libkrb5support0:riscv64 (1.19.2-2) ... (Reading database ... 13186 files and directories currently installed.) Preparing to unpack .../libkrb5-3_1.19.2-2_riscv64.deb ... Unpacking libkrb5-3:riscv64 (1.19.2-2) over (1.18.3-6) ... Setting up libkrb5-3:riscv64 (1.19.2-2) ... (Reading database ... 13186 files and directories currently installed.) Preparing to unpack .../libgssapi-krb5-2_1.19.2-2_riscv64.deb ... Unpacking libgssapi-krb5-2:riscv64 (1.19.2-2) over (1.18.3-6) ... Setting up libgssapi-krb5-2:riscv64 (1.19.2-2) ... (Reading database ... 13186 files and directories currently installed.) Preparing to unpack .../perl_5.34.0-3ubuntu1_riscv64.deb ... Unpacking perl (5.34.0-3ubuntu1) over (5.32.1-3ubuntu3) ... Selecting previously unselected package perl-modules-5.34. Preparing to unpack .../perl-modules-5.34_5.34.0-3ubuntu1_all.deb ... Unpacking perl-modules-5.34 (5.34.0-3ubuntu1) ... Selecting previously unselected package libperl5.34:riscv64. Preparing to unpack .../libperl5.34_5.34.0-3ubuntu1_riscv64.deb ... Unpacking libperl5.34:riscv64 (5.34.0-3ubuntu1) ... Preparing to unpack .../perl-base_5.34.0-3ubuntu1_riscv64.deb ... Unpacking perl-base (5.34.0-3ubuntu1) over (5.32.1-3ubuntu3) ... Setting up perl-base (5.34.0-3ubuntu1) ... (Reading database ... 15092 files and directories currently installed.) Preparing to unpack .../bzip2_1.0.8-5build1_riscv64.deb ... Unpacking bzip2 (1.0.8-5build1) over (1.0.8-4ubuntu4) ... Preparing to unpack .../libbz2-1.0_1.0.8-5build1_riscv64.deb ... Unpacking libbz2-1.0:riscv64 (1.0.8-5build1) over (1.0.8-4ubuntu4) ... Setting up libbz2-1.0:riscv64 (1.0.8-5build1) ... (Reading database ... 15092 files and directories currently installed.) Preparing to unpack .../libaudit-common_1%3a3.0.7-1build1_all.deb ... Unpacking libaudit-common (1:3.0.7-1build1) over (1:3.0-2ubuntu3) ... Setting up libaudit-common (1:3.0.7-1build1) ... (Reading database ... 15092 files and directories currently installed.) Preparing to unpack .../libcap-ng0_0.7.9-2.2build3_riscv64.deb ... Unpacking libcap-ng0:riscv64 (0.7.9-2.2build3) over (0.7.9-2.2build2) ... Setting up libcap-ng0:riscv64 (0.7.9-2.2build3) ... (Reading database ... 15092 files and directories currently installed.) Preparing to unpack .../libaudit1_1%3a3.0.7-1build1_riscv64.deb ... Unpacking libaudit1:riscv64 (1:3.0.7-1build1) over (1:3.0-2ubuntu3) ... Setting up libaudit1:riscv64 (1:3.0.7-1build1) ... (Reading database ... 15092 files and directories currently installed.) Preparing to unpack .../libpam0g_1.4.0-11ubuntu2_riscv64.deb ... Unpacking libpam0g:riscv64 (1.4.0-11ubuntu2) over (1.3.1-5ubuntu11) ... Setting up libpam0g:riscv64 (1.4.0-11ubuntu2) ... Checking for services that may need to be restarted...Checking init scripts... Nothing to restart. (Reading database ... 15092 files and directories currently installed.) Preparing to unpack .../libcrypt1_1%3a4.4.27-1_riscv64.deb ... Unpacking libcrypt1:riscv64 (1:4.4.27-1) over (1:4.4.18-4ubuntu2) ... Setting up libcrypt1:riscv64 (1:4.4.27-1) ... (Reading database ... 15092 files and directories currently installed.) Preparing to unpack .../libdb5.3_5.3.28+dfsg1-0.8ubuntu3_riscv64.deb ... Unpacking libdb5.3:riscv64 (5.3.28+dfsg1-0.8ubuntu3) over (5.3.28+dfsg1-0.8ubuntu2) ... Setting up libdb5.3:riscv64 (5.3.28+dfsg1-0.8ubuntu3) ... (Reading database ... 15092 files and directories currently installed.) Preparing to unpack .../libgdbm6_1.23-1_riscv64.deb ... Unpacking libgdbm6:riscv64 (1.23-1) over (1.19-2build1) ... Preparing to unpack .../libgdbm-compat4_1.23-1_riscv64.deb ... Unpacking libgdbm-compat4:riscv64 (1.23-1) over (1.19-2build1) ... Preparing to unpack .../zlib1g_1%3a1.2.11.dfsg-2ubuntu9_riscv64.deb ... Unpacking zlib1g:riscv64 (1:1.2.11.dfsg-2ubuntu9) over (1:1.2.11.dfsg-2ubuntu7) ... Setting up zlib1g:riscv64 (1:1.2.11.dfsg-2ubuntu9) ... (Reading database ... 15092 files and directories currently installed.) Preparing to unpack .../debconf_1.5.79ubuntu1_all.deb ... Unpacking debconf (1.5.79ubuntu1) over (1.5.77) ... Setting up debconf (1.5.79ubuntu1) ... (Reading database ... 15091 files and directories currently installed.) Preparing to unpack .../libcom-err2_1.46.5-2ubuntu1_riscv64.deb ... Unpacking libcom-err2:riscv64 (1.46.5-2ubuntu1) over (1.46.3-1ubuntu3) ... Setting up libcom-err2:riscv64 (1.46.5-2ubuntu1) ... (Reading database ... 15091 files and directories currently installed.) Preparing to unpack .../libkeyutils1_1.6.1-2ubuntu3_riscv64.deb ... Unpacking libkeyutils1:riscv64 (1.6.1-2ubuntu3) over (1.6.1-2ubuntu2) ... Setting up libkeyutils1:riscv64 (1.6.1-2ubuntu3) ... (Reading database ... 15091 files and directories currently installed.) Preparing to unpack .../libtirpc3_1.3.2-2build1_riscv64.deb ... Unpacking libtirpc3:riscv64 (1.3.2-2build1) over (1.3.2-2) ... Setting up libtirpc3:riscv64 (1.3.2-2build1) ... (Reading database ... 15091 files and directories currently installed.) Preparing to unpack .../libnsl2_1.3.0-2build2_riscv64.deb ... Unpacking libnsl2:riscv64 (1.3.0-2build2) over (1.3.0-2build1) ... Setting up libnsl2:riscv64 (1.3.0-2build2) ... (Reading database ... 15091 files and directories currently installed.) Preparing to unpack .../linux-libc-dev_5.15.0-25.25_riscv64.deb ... Unpacking linux-libc-dev:riscv64 (5.15.0-25.25) over (5.13.0-19.19) ... Preparing to unpack .../libc6_2.35-0ubuntu3_riscv64.deb ... Unpacking libc6:riscv64 (2.35-0ubuntu3) over (2.34-0ubuntu3) ... Setting up libc6:riscv64 (2.35-0ubuntu3) ... (Reading database ... 15101 files and directories currently installed.) Preparing to unpack .../libc-bin_2.35-0ubuntu3_riscv64.deb ... Unpacking libc-bin (2.35-0ubuntu3) over (2.34-0ubuntu3) ... Setting up libc-bin (2.35-0ubuntu3) ... Selecting previously unselected package gcc-12-base:riscv64. (Reading database ... 15099 files and directories currently installed.) Preparing to unpack .../gcc-12-base_12-20220319-1ubuntu1_riscv64.deb ... Unpacking gcc-12-base:riscv64 (12-20220319-1ubuntu1) ... Setting up gcc-12-base:riscv64 (12-20220319-1ubuntu1) ... (Reading database ... 15104 files and directories currently installed.) Preparing to unpack .../libgcc-s1_12-20220319-1ubuntu1_riscv64.deb ... Unpacking libgcc-s1:riscv64 (12-20220319-1ubuntu1) over (11.2.0-7ubuntu2) ... Setting up libgcc-s1:riscv64 (12-20220319-1ubuntu1) ... (Reading database ... 15104 files and directories currently installed.) Preparing to unpack .../base-files_12ubuntu4_riscv64.deb ... Unpacking base-files (12ubuntu4) over (12ubuntu1) ... Setting up base-files (12ubuntu4) ... Installing new version of config file /etc/issue ... Installing new version of config file /etc/issue.net ... Installing new version of config file /etc/lsb-release ... (Reading database ... 15104 files and directories currently installed.) Preparing to unpack .../debianutils_5.5-1ubuntu2_riscv64.deb ... Unpacking debianutils (5.5-1ubuntu2) over (4.11.2build1) ... Setting up debianutils (5.5-1ubuntu2) ... update-alternatives: using /usr/bin/which.debianutils to provide /usr/bin/which (which) in auto mode (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../bash_5.1-6ubuntu1_riscv64.deb ... Unpacking bash (5.1-6ubuntu1) over (5.1-3ubuntu2) ... Setting up bash (5.1-6ubuntu1) ... update-alternatives: using /usr/share/man/man7/bash-builtins.7.gz to provide /usr/share/man/man7/builtins.7.gz (builtins.7.gz) in auto mode (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../bsdutils_1%3a2.37.2-4ubuntu3_riscv64.deb ... Unpacking bsdutils (1:2.37.2-4ubuntu3) over (1:2.36.1-8ubuntu1) ... Setting up bsdutils (1:2.37.2-4ubuntu3) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../coreutils_8.32-4.1ubuntu1_riscv64.deb ... Unpacking coreutils (8.32-4.1ubuntu1) over (8.32-4ubuntu3) ... Setting up coreutils (8.32-4.1ubuntu1) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../libgpg-error0_1.43-3_riscv64.deb ... Unpacking libgpg-error0:riscv64 (1.43-3) over (1.38-2build2) ... Setting up libgpg-error0:riscv64 (1.43-3) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../libgcrypt20_1.9.4-3ubuntu3_riscv64.deb ... Unpacking libgcrypt20:riscv64 (1.9.4-3ubuntu3) over (1.8.7-5ubuntu2) ... Setting up libgcrypt20:riscv64 (1.9.4-3ubuntu3) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../liblz4-1_1.9.3-2build2_riscv64.deb ... Unpacking liblz4-1:riscv64 (1.9.3-2build2) over (1.9.3-2build1) ... Setting up liblz4-1:riscv64 (1.9.3-2build2) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../liblzma5_5.2.5-2ubuntu1_riscv64.deb ... Unpacking liblzma5:riscv64 (5.2.5-2ubuntu1) over (5.2.5-2build1) ... Setting up liblzma5:riscv64 (5.2.5-2ubuntu1) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../libstdc++6_12-20220319-1ubuntu1_riscv64.deb ... Unpacking libstdc++6:riscv64 (12-20220319-1ubuntu1) over (11.2.0-7ubuntu2) ... Setting up libstdc++6:riscv64 (12-20220319-1ubuntu1) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../libargon2-1_0~20171227-0.3_riscv64.deb ... Unpacking libargon2-1:riscv64 (0~20171227-0.3) over (0~20171227-0.2build22) ... Preparing to unpack .../libblkid1_2.37.2-4ubuntu3_riscv64.deb ... Unpacking libblkid1:riscv64 (2.37.2-4ubuntu3) over (2.36.1-8ubuntu1) ... Setting up libblkid1:riscv64 (2.37.2-4ubuntu3) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../libpcre2-8-0_10.39-3build1_riscv64.deb ... Unpacking libpcre2-8-0:riscv64 (10.39-3build1) over (10.37-0ubuntu2) ... Setting up libpcre2-8-0:riscv64 (10.39-3build1) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../libselinux1_3.3-1build2_riscv64.deb ... Unpacking libselinux1:riscv64 (3.3-1build2) over (3.1-3build2) ... Setting up libselinux1:riscv64 (3.3-1build2) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../libudev1_249.11-0ubuntu3_riscv64.deb ... Unpacking libudev1:riscv64 (249.11-0ubuntu3) over (248.3-1ubuntu8) ... Setting up libudev1:riscv64 (249.11-0ubuntu3) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../libdevmapper1.02.1_2%3a1.02.175-2.1ubuntu4_riscv64.deb ... Unpacking libdevmapper1.02.1:riscv64 (2:1.02.175-2.1ubuntu4) over (2:1.02.175-2.1ubuntu3) ... Preparing to unpack .../libjson-c5_0.15-2build4_riscv64.deb ... Unpacking libjson-c5:riscv64 (0.15-2build4) over (0.15-2build3) ... Preparing to unpack .../libuuid1_2.37.2-4ubuntu3_riscv64.deb ... Unpacking libuuid1:riscv64 (2.37.2-4ubuntu3) over (2.36.1-8ubuntu1) ... Setting up libuuid1:riscv64 (2.37.2-4ubuntu3) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../libcryptsetup12_2%3a2.4.3-1ubuntu1_riscv64.deb ... Unpacking libcryptsetup12:riscv64 (2:2.4.3-1ubuntu1) over (2:2.3.6-0ubuntu1) ... Preparing to unpack .../libgmp10_2%3a6.2.1+dfsg-3ubuntu1_riscv64.deb ... Unpacking libgmp10:riscv64 (2:6.2.1+dfsg-3ubuntu1) over (2:6.2.1+dfsg-1ubuntu3) ... Setting up libgmp10:riscv64 (2:6.2.1+dfsg-3ubuntu1) ... (Reading database ... 15110 files and directories currently installed.) Preparing to unpack .../libnettle8_3.7.3-1build2_riscv64.deb ... Unpacking libnettle8:riscv64 (3.7.3-1build2) over (3.7.3-1build1) ... Setting up libnettle8:riscv64 (3.7.3-1build2) ... (Reading database ... 15110 files and directories currently installed.) Preparing to unpack .../libhogweed6_3.7.3-1build2_riscv64.deb ... Unpacking libhogweed6:riscv64 (3.7.3-1build2) over (3.7.3-1build1) ... Setting up libhogweed6:riscv64 (3.7.3-1build2) ... (Reading database ... 15110 files and directories currently installed.) Preparing to unpack .../libunistring2_1.0-1_riscv64.deb ... Unpacking libunistring2:riscv64 (1.0-1) over (0.9.10-6) ... Setting up libunistring2:riscv64 (1.0-1) ... (Reading database ... 15110 files and directories currently installed.) Preparing to unpack .../libidn2-0_2.3.2-2build1_riscv64.deb ... Unpacking libidn2-0:riscv64 (2.3.2-2build1) over (2.3.1-1build1) ... Setting up libidn2-0:riscv64 (2.3.2-2build1) ... (Reading database ... 15110 files and directories currently installed.) Preparing to unpack .../libffi8_3.4.2-4_riscv64.deb ... Unpacking libffi8:riscv64 (3.4.2-4) over (3.4.2-1ubuntu5) ... Setting up libffi8:riscv64 (3.4.2-4) ... (Reading database ... 15110 files and directories currently installed.) Preparing to unpack .../libp11-kit0_0.24.0-6build1_riscv64.deb ... Unpacking libp11-kit0:riscv64 (0.24.0-6build1) over (0.23.22-1build1) ... Setting up libp11-kit0:riscv64 (0.24.0-6build1) ... (Reading database ... 15110 files and directories currently installed.) Preparing to unpack .../libtasn1-6_4.18.0-4build1_riscv64.deb ... Unpacking libtasn1-6:riscv64 (4.18.0-4build1) over (4.16.0-2build1) ... Setting up libtasn1-6:riscv64 (4.18.0-4build1) ... (Reading database ... 15110 files and directories currently installed.) Preparing to unpack .../libgnutls30_3.7.3-4ubuntu1_riscv64.deb ... Unpacking libgnutls30:riscv64 (3.7.3-4ubuntu1) over (3.7.1-5ubuntu1) ... Setting up libgnutls30:riscv64 (3.7.3-4ubuntu1) ... (Reading database ... 15110 files and directories currently installed.) Preparing to unpack .../systemd-sysv_249.11-0ubuntu3_riscv64.deb ... Unpacking systemd-sysv (249.11-0ubuntu3) over (248.3-1ubuntu8) ... Preparing to unpack .../systemd-timesyncd_249.11-0ubuntu3_riscv64.deb ... Unpacking systemd-timesyncd (249.11-0ubuntu3) over (248.3-1ubuntu8) ... Preparing to unpack .../libacl1_2.3.1-1_riscv64.deb ... Unpacking libacl1:riscv64 (2.3.1-1) over (2.2.53-10ubuntu2) ... Setting up libacl1:riscv64 (2.3.1-1) ... (Reading database ... 15111 files and directories currently installed.) Preparing to unpack .../libapparmor1_3.0.4-2ubuntu2_riscv64.deb ... Unpacking libapparmor1:riscv64 (3.0.4-2ubuntu2) over (3.0.3-0ubuntu1) ... Preparing to unpack .../libip4tc2_1.8.7-1ubuntu5_riscv64.deb ... Unpacking libip4tc2:riscv64 (1.8.7-1ubuntu5) over (1.8.7-1ubuntu3) ... Preparing to unpack .../libzstd1_1.4.8+dfsg-3build1_riscv64.deb ... Unpacking libzstd1:riscv64 (1.4.8+dfsg-3build1) over (1.4.8+dfsg-2.1build1) ... Setting up libzstd1:riscv64 (1.4.8+dfsg-3build1) ... (Reading database ... 15110 files and directories currently installed.) Preparing to unpack .../libkmod2_29-1ubuntu1_riscv64.deb ... Unpacking libkmod2:riscv64 (29-1ubuntu1) over (28-1ubuntu4) ... Preparing to unpack .../libmount1_2.37.2-4ubuntu3_riscv64.deb ... Unpacking libmount1:riscv64 (2.37.2-4ubuntu3) over (2.36.1-8ubuntu1) ... Setting up libmount1:riscv64 (2.37.2-4ubuntu3) ... (Reading database ... 15110 files and directories currently installed.) Preparing to unpack .../libseccomp2_2.5.3-2ubuntu2_riscv64.deb ... Unpacking libseccomp2:riscv64 (2.5.3-2ubuntu2) over (2.5.1-1ubuntu1) ... Preparing to unpack .../login_1%3a4.8.1-2ubuntu2_riscv64.deb ... Unpacking login (1:4.8.1-2ubuntu2) over (1:4.8.1-1ubuntu9) ... Setting up login (1:4.8.1-2ubuntu2) ... (Reading database ... 15110 files and directories currently installed.) Preparing to unpack .../util-linux_2.37.2-4ubuntu3_riscv64.deb ... Unpacking util-linux (2.37.2-4ubuntu3) over (2.36.1-8ubuntu1) ... Setting up util-linux (2.37.2-4ubuntu3) ... (Reading database ... 15105 files and directories currently installed.) Preparing to unpack .../mount_2.37.2-4ubuntu3_riscv64.deb ... Unpacking mount (2.37.2-4ubuntu3) over (2.36.1-8ubuntu1) ... Preparing to unpack .../systemd_249.11-0ubuntu3_riscv64.deb ... Unpacking systemd (249.11-0ubuntu3) over (248.3-1ubuntu8) ... Preparing to unpack .../libsystemd0_249.11-0ubuntu3_riscv64.deb ... Unpacking libsystemd0:riscv64 (249.11-0ubuntu3) over (248.3-1ubuntu8) ... Setting up libsystemd0:riscv64 (249.11-0ubuntu3) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../libxxhash0_0.8.1-1_riscv64.deb ... Unpacking libxxhash0:riscv64 (0.8.1-1) over (0.8.0-2build1) ... Setting up libxxhash0:riscv64 (0.8.1-1) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../libapt-pkg6.0_2.4.5_riscv64.deb ... Unpacking libapt-pkg6.0:riscv64 (2.4.5) over (2.3.9) ... Setting up libapt-pkg6.0:riscv64 (2.4.5) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../tar_1.34+dfsg-1build3_riscv64.deb ... Unpacking tar (1.34+dfsg-1build3) over (1.34+dfsg-1build2) ... Setting up tar (1.34+dfsg-1build3) ... (Reading database ... 15108 files and directories currently installed.) Preparing to unpack .../dpkg_1.21.1ubuntu11_riscv64.deb ... Unpacking dpkg (1.21.1ubuntu11) over (1.20.9ubuntu2) ... Setting up dpkg (1.21.1ubuntu11) ... Installing new version of config file /etc/cron.daily/dpkg ... Created symlink /etc/systemd/system/timers.target.wants/dpkg-db-backup.timer -> /lib/systemd/system/dpkg-db-backup.timer. (Reading database ... 15114 files and directories currently installed.) Preparing to unpack .../dash_0.5.11+git20210903+057cd650a4ed-3build1_riscv64.deb ... Unpacking dash (0.5.11+git20210903+057cd650a4ed-3build1) over (0.5.11+git20210120+802ebd4-1build1) ... Setting up dash (0.5.11+git20210903+057cd650a4ed-3build1) ... (Reading database ... 15114 files and directories currently installed.) Preparing to unpack .../diffutils_1%3a3.8-0ubuntu2_riscv64.deb ... Unpacking diffutils (1:3.8-0ubuntu2) over (1:3.8-0ubuntu1) ... Setting up diffutils (1:3.8-0ubuntu2) ... (Reading database ... 15114 files and directories currently installed.) Preparing to unpack .../findutils_4.8.0-1ubuntu3_riscv64.deb ... Unpacking findutils (4.8.0-1ubuntu3) over (4.8.0-1ubuntu2) ... Setting up findutils (4.8.0-1ubuntu3) ... (Reading database ... 15114 files and directories currently installed.) Preparing to unpack .../grep_3.7-1build1_riscv64.deb ... Unpacking grep (3.7-1build1) over (3.7-0ubuntu1) ... Setting up grep (3.7-1build1) ... (Reading database ... 15114 files and directories currently installed.) Preparing to unpack .../gzip_1.10-4ubuntu4_riscv64.deb ... Unpacking gzip (1.10-4ubuntu4) over (1.10-4ubuntu2) ... Setting up gzip (1.10-4ubuntu4) ... (Reading database ... 15114 files and directories currently installed.) Preparing to unpack .../hostname_3.23ubuntu2_riscv64.deb ... Unpacking hostname (3.23ubuntu2) over (3.23ubuntu1) ... Setting up hostname (3.23ubuntu2) ... (Reading database ... 15114 files and directories currently installed.) Preparing to unpack .../libncurses6_6.3-2_riscv64.deb ... Unpacking libncurses6:riscv64 (6.3-2) over (6.2+20201114-2build2) ... Preparing to unpack .../libncursesw6_6.3-2_riscv64.deb ... Unpacking libncursesw6:riscv64 (6.3-2) over (6.2+20201114-2build2) ... Preparing to unpack .../libtinfo6_6.3-2_riscv64.deb ... Unpacking libtinfo6:riscv64 (6.3-2) over (6.2+20201114-2build2) ... Setting up libtinfo6:riscv64 (6.3-2) ... (Reading database ... 15113 files and directories currently installed.) Preparing to unpack .../ncurses-bin_6.3-2_riscv64.deb ... Unpacking ncurses-bin (6.3-2) over (6.2+20201114-2build2) ... Setting up ncurses-bin (6.3-2) ... (Reading database ... 15113 files and directories currently installed.) Preparing to unpack .../sed_4.8-1ubuntu2_riscv64.deb ... Unpacking sed (4.8-1ubuntu2) over (4.7-1ubuntu2) ... Setting up sed (4.8-1ubuntu2) ... (Reading database ... 15113 files and directories currently installed.) Preparing to unpack .../libdebconfclient0_0.261ubuntu1_riscv64.deb ... Unpacking libdebconfclient0:riscv64 (0.261ubuntu1) over (0.256ubuntu4) ... Setting up libdebconfclient0:riscv64 (0.261ubuntu1) ... (Reading database ... 15113 files and directories currently installed.) Preparing to unpack .../base-passwd_3.5.52build1_riscv64.deb ... Unpacking base-passwd (3.5.52build1) over (3.5.52) ... Setting up base-passwd (3.5.52build1) ... (Reading database ... 15113 files and directories currently installed.) Preparing to unpack .../init-system-helpers_1.62_all.deb ... Unpacking init-system-helpers (1.62) over (1.60build1) ... Setting up init-system-helpers (1.62) ... (Reading database ... 15113 files and directories currently installed.) Preparing to unpack .../ncurses-base_6.3-2_all.deb ... Unpacking ncurses-base (6.3-2) over (6.2+20201114-2build2) ... Setting up ncurses-base (6.3-2) ... (Reading database ... 15114 files and directories currently installed.) Preparing to unpack .../lsb-base_11.1.0ubuntu4_all.deb ... Unpacking lsb-base (11.1.0ubuntu4) over (11.1.0ubuntu3) ... Setting up lsb-base (11.1.0ubuntu4) ... (Reading database ... 15114 files and directories currently installed.) Preparing to unpack .../sysvinit-utils_3.01-1ubuntu1_riscv64.deb ... Unpacking sysvinit-utils (3.01-1ubuntu1) over (2.96-7ubuntu2) ... Setting up sysvinit-utils (3.01-1ubuntu1) ... (Reading database ... 15114 files and directories currently installed.) Preparing to unpack .../gpgv_2.2.27-3ubuntu2_riscv64.deb ... Unpacking gpgv (2.2.27-3ubuntu2) over (2.2.20-1ubuntu4) ... Setting up gpgv (2.2.27-3ubuntu2) ... (Reading database ... 15114 files and directories currently installed.) Preparing to unpack .../archives/apt_2.4.5_riscv64.deb ... Unpacking apt (2.4.5) over (2.3.9) ... Setting up apt (2.4.5) ... Installing new version of config file /etc/cron.daily/apt-compat ... Removing obsolete conffile /etc/kernel/postinst.d/apt-auto-removal ... Selecting previously unselected package libsepol2:riscv64. (Reading database ... 15109 files and directories currently installed.) Preparing to unpack .../libsepol2_3.3-1build1_riscv64.deb ... Unpacking libsepol2:riscv64 (3.3-1build1) ... Setting up libsepol2:riscv64 (3.3-1build1) ... (Reading database ... 15113 files and directories currently installed.) Preparing to unpack .../libsemanage-common_3.3-1build2_all.deb ... Unpacking libsemanage-common (3.3-1build2) over (3.1-1ubuntu3) ... Setting up libsemanage-common (3.3-1build2) ... Selecting previously unselected package libsemanage2:riscv64. (Reading database ... 15113 files and directories currently installed.) Preparing to unpack .../libsemanage2_3.3-1build2_riscv64.deb ... Unpacking libsemanage2:riscv64 (3.3-1build2) ... Setting up libsemanage2:riscv64 (3.3-1build2) ... (Reading database ... 15117 files and directories currently installed.) Preparing to unpack .../passwd_1%3a4.8.1-2ubuntu2_riscv64.deb ... Unpacking passwd (1:4.8.1-2ubuntu2) over (1:4.8.1-1ubuntu9) ... Setting up passwd (1:4.8.1-2ubuntu2) ... (Reading database ... 15124 files and directories currently installed.) Removing libsemanage1:riscv64 (3.1-1ubuntu3) ... (Reading database ... 15120 files and directories currently installed.) Preparing to unpack .../libpam-modules-bin_1.4.0-11ubuntu2_riscv64.deb ... Unpacking libpam-modules-bin (1.4.0-11ubuntu2) over (1.3.1-5ubuntu11) ... Setting up libpam-modules-bin (1.4.0-11ubuntu2) ... (Reading database ... 15118 files and directories currently installed.) Preparing to unpack .../libpam-modules_1.4.0-11ubuntu2_riscv64.deb ... Unpacking libpam-modules:riscv64 (1.4.0-11ubuntu2) over (1.3.1-5ubuntu11) ... Setting up libpam-modules:riscv64 (1.4.0-11ubuntu2) ... Installing new version of config file /etc/security/namespace.conf ... Installing new version of config file /etc/security/pam_env.conf ... (Reading database ... 15119 files and directories currently installed.) Preparing to unpack .../logsave_1.46.5-2ubuntu1_riscv64.deb ... Unpacking logsave (1.46.5-2ubuntu1) over (1.46.3-1ubuntu3) ... Preparing to unpack .../libext2fs2_1.46.5-2ubuntu1_riscv64.deb ... Unpacking libext2fs2:riscv64 (1.46.5-2ubuntu1) over (1.46.3-1ubuntu3) ... Setting up libext2fs2:riscv64 (1.46.5-2ubuntu1) ... (Reading database ... 15119 files and directories currently installed.) Preparing to unpack .../e2fsprogs_1.46.5-2ubuntu1_riscv64.deb ... Unpacking e2fsprogs (1.46.5-2ubuntu1) over (1.46.3-1ubuntu3) ... Setting up libapparmor1:riscv64 (3.0.4-2ubuntu2) ... Setting up libargon2-1:riscv64 (0~20171227-0.3) ... Setting up libdevmapper1.02.1:riscv64 (2:1.02.175-2.1ubuntu4) ... Setting up libjson-c5:riscv64 (0.15-2build4) ... Setting up libcryptsetup12:riscv64 (2:2.4.3-1ubuntu1) ... Setting up libip4tc2:riscv64 (1.8.7-1ubuntu5) ... Setting up libkmod2:riscv64 (29-1ubuntu1) ... Setting up libseccomp2:riscv64 (2.5.3-2ubuntu2) ... Setting up mount (2.37.2-4ubuntu3) ... Setting up systemd (249.11-0ubuntu3) ... Installing new version of config file /etc/systemd/logind.conf ... Installing new version of config file /etc/systemd/networkd.conf ... Installing new version of config file /etc/systemd/resolved.conf ... Initializing machine ID from random generator. Setting up systemd-sysv (249.11-0ubuntu3) ... (Reading database ... 15119 files and directories currently installed.) Preparing to unpack .../archives/init_1.62_riscv64.deb ... Unpacking init (1.62) over (1.60build1) ... Selecting previously unselected package libpython3.10-minimal:riscv64. Preparing to unpack .../libpython3.10-minimal_3.10.4-3_riscv64.deb ... Unpacking libpython3.10-minimal:riscv64 (3.10.4-3) ... Selecting previously unselected package libexpat1:riscv64. Preparing to unpack .../libexpat1_2.4.7-1_riscv64.deb ... Unpacking libexpat1:riscv64 (2.4.7-1) ... Selecting previously unselected package python3.10-minimal. Preparing to unpack .../python3.10-minimal_3.10.4-3_riscv64.deb ... Unpacking python3.10-minimal (3.10.4-3) ... Setting up libpython3.10-minimal:riscv64 (3.10.4-3) ... Setting up libexpat1:riscv64 (2.4.7-1) ... Setting up python3.10-minimal (3.10.4-3) ... Selecting previously unselected package python3-minimal. (Reading database ... 15421 files and directories currently installed.) Preparing to unpack .../0-python3-minimal_3.10.4-0ubuntu2_riscv64.deb ... Unpacking python3-minimal (3.10.4-0ubuntu2) ... Selecting previously unselected package media-types. Preparing to unpack .../1-media-types_7.0.0_all.deb ... Unpacking media-types (7.0.0) ... Selecting previously unselected package libmpdec3:riscv64. Preparing to unpack .../2-libmpdec3_2.5.1-2build2_riscv64.deb ... Unpacking libmpdec3:riscv64 (2.5.1-2build2) ... Preparing to unpack .../3-readline-common_8.1.2-1_all.deb ... Unpacking readline-common (8.1.2-1) over (8.1-2build1) ... Preparing to unpack .../4-libreadline8_8.1.2-1_riscv64.deb ... Unpacking libreadline8:riscv64 (8.1.2-1) over (8.1-2build1) ... Preparing to unpack .../5-libsqlite3-0_3.37.2-2_riscv64.deb ... Unpacking libsqlite3-0:riscv64 (3.37.2-2) over (3.35.5-1) ... Selecting previously unselected package libpython3.10-stdlib:riscv64. Preparing to unpack .../6-libpython3.10-stdlib_3.10.4-3_riscv64.deb ... Unpacking libpython3.10-stdlib:riscv64 (3.10.4-3) ... Selecting previously unselected package python3.10. Preparing to unpack .../7-python3.10_3.10.4-3_riscv64.deb ... Unpacking python3.10 (3.10.4-3) ... Selecting previously unselected package libpython3-stdlib:riscv64. Preparing to unpack .../8-libpython3-stdlib_3.10.4-0ubuntu2_riscv64.deb ... Unpacking libpython3-stdlib:riscv64 (3.10.4-0ubuntu2) ... Setting up python3-minimal (3.10.4-0ubuntu2) ... Selecting previously unselected package python3. (Reading database ... 15822 files and directories currently installed.) Preparing to unpack .../python3_3.10.4-0ubuntu2_riscv64.deb ... Unpacking python3 (3.10.4-0ubuntu2) ... Preparing to unpack .../libattr1_1%3a2.5.1-1build1_riscv64.deb ... Unpacking libattr1:riscv64 (1:2.5.1-1build1) over (1:2.4.48-6build2) ... Setting up libattr1:riscv64 (1:2.5.1-1build1) ... Installing new version of config file /etc/xattr.conf ... (Reading database ... 15842 files and directories currently installed.) Preparing to unpack .../libcap2_1%3a2.44-1build3_riscv64.deb ... Unpacking libcap2:riscv64 (1:2.44-1build3) over (1:2.44-1build2) ... Setting up libcap2:riscv64 (1:2.44-1build3) ... (Reading database ... 15842 files and directories currently installed.) Preparing to unpack .../libpam-runtime_1.4.0-11ubuntu2_all.deb ... Unpacking libpam-runtime (1.4.0-11ubuntu2) over (1.3.1-5ubuntu11) ... Setting up libpam-runtime (1.4.0-11ubuntu2) ... (Reading database ... 15842 files and directories currently installed.) Preparing to unpack .../libpcre3_2%3a8.39-13build5_riscv64.deb ... Unpacking libpcre3:riscv64 (2:8.39-13build5) over (2:8.39-13build4) ... Setting up libpcre3:riscv64 (2:8.39-13build5) ... (Reading database ... 15842 files and directories currently installed.) Preparing to unpack .../libsmartcols1_2.37.2-4ubuntu3_riscv64.deb ... Unpacking libsmartcols1:riscv64 (2.37.2-4ubuntu3) over (2.36.1-8ubuntu1) ... Setting up libsmartcols1:riscv64 (2.37.2-4ubuntu3) ... (Reading database ... 15842 files and directories currently installed.) Preparing to unpack .../00-libprocps8_2%3a3.3.17-6ubuntu2_riscv64.deb ... Unpacking libprocps8:riscv64 (2:3.3.17-6ubuntu2) over (2:3.3.17-5ubuntu3) ... Preparing to unpack .../01-libss2_1.46.5-2ubuntu1_riscv64.deb ... Unpacking libss2:riscv64 (1.46.5-2ubuntu1) over (1.46.3-1ubuntu3) ... Preparing to unpack .../02-mawk_1.3.4.20200120-3_riscv64.deb ... Unpacking mawk (1.3.4.20200120-3) over (1.3.4.20200120-2build1) ... Preparing to unpack .../03-procps_2%3a3.3.17-6ubuntu2_riscv64.deb ... Unpacking procps (2:3.3.17-6ubuntu2) over (2:3.3.17-5ubuntu3) ... Preparing to unpack .../04-sensible-utils_0.0.17_all.deb ... Unpacking sensible-utils (0.0.17) over (0.0.14) ... Preparing to unpack .../05-usrmerge_25ubuntu2_all.deb ... Unpacking usrmerge (25ubuntu2) over (25ubuntu1) ... Preparing to unpack .../06-openssl_3.0.2-0ubuntu1_riscv64.deb ... Unpacking openssl (3.0.2-0ubuntu1) over (1.1.1l-1ubuntu1) ... Preparing to unpack .../07-ca-certificates_20211016_all.deb ... Unpacking ca-certificates (20211016) over (20210119ubuntu1) ... Preparing to unpack .../08-tzdata_2022a-0ubuntu1_all.deb ... Unpacking tzdata (2022a-0ubuntu1) over (2021a-2ubuntu1) ... Preparing to unpack .../09-libpng16-16_1.6.37-3build5_riscv64.deb ... Unpacking libpng16-16:riscv64 (1.6.37-3build5) over (1.6.37-3build4) ... Preparing to unpack .../10-xz-utils_5.2.5-2ubuntu1_riscv64.deb ... Unpacking xz-utils (5.2.5-2ubuntu1) over (5.2.5-2build1) ... Preparing to unpack .../11-advancecomp_2.1-2.1ubuntu2_riscv64.deb ... Unpacking advancecomp (2.1-2.1ubuntu2) over (2.1-2.1ubuntu1) ... Preparing to unpack .../12-libctf0_2.38-3ubuntu1_riscv64.deb ... Unpacking libctf0:riscv64 (2.38-3ubuntu1) over (2.37-7ubuntu1) ... Preparing to unpack .../13-libctf-nobfd0_2.38-3ubuntu1_riscv64.deb ... Unpacking libctf-nobfd0:riscv64 (2.38-3ubuntu1) over (2.37-7ubuntu1) ... Preparing to unpack .../14-binutils-riscv64-linux-gnu_2.38-3ubuntu1_riscv64.deb ... Unpacking binutils-riscv64-linux-gnu (2.38-3ubuntu1) over (2.37-7ubuntu1) ... Preparing to unpack .../15-libbinutils_2.38-3ubuntu1_riscv64.deb ... Unpacking libbinutils:riscv64 (2.38-3ubuntu1) over (2.37-7ubuntu1) ... Preparing to unpack .../16-binutils_2.38-3ubuntu1_riscv64.deb ... Unpacking binutils (2.38-3ubuntu1) over (2.37-7ubuntu1) ... Preparing to unpack .../17-binutils-common_2.38-3ubuntu1_riscv64.deb ... Unpacking binutils-common:riscv64 (2.38-3ubuntu1) over (2.37-7ubuntu1) ... Preparing to unpack .../18-libisl23_0.24-2build1_riscv64.deb ... Unpacking libisl23:riscv64 (0.24-2build1) over (0.24-1build1) ... Preparing to unpack .../19-libmpfr6_4.1.0-3build3_riscv64.deb ... Unpacking libmpfr6:riscv64 (4.1.0-3build3) over (4.1.0-3build2) ... Preparing to unpack .../20-libmpc3_1.2.1-2build1_riscv64.deb ... Unpacking libmpc3:riscv64 (1.2.1-2build1) over (1.2.0-1build2) ... Selecting previously unselected package cpp-12. Preparing to unpack .../21-cpp-12_12-20220319-1ubuntu1_riscv64.deb ... Unpacking cpp-12 (12-20220319-1ubuntu1) ... Preparing to unpack .../22-g++_4%3a12-20211211-1ubuntu2_riscv64.deb ... Unpacking g++ (4:12-20211211-1ubuntu2) over (4:11.2.0-1ubuntu1) ... Preparing to unpack .../23-gcc_4%3a12-20211211-1ubuntu2_riscv64.deb ... Unpacking gcc (4:12-20211211-1ubuntu2) over (4:11.2.0-1ubuntu1) ... Preparing to unpack .../24-cpp_4%3a12-20211211-1ubuntu2_riscv64.deb ... Unpacking cpp (4:12-20211211-1ubuntu2) over (4:11.2.0-1ubuntu1) ... Preparing to unpack .../25-libcc1-0_12-20220319-1ubuntu1_riscv64.deb ... Unpacking libcc1-0:riscv64 (12-20220319-1ubuntu1) over (11.2.0-7ubuntu2) ... Preparing to unpack .../26-libgomp1_12-20220319-1ubuntu1_riscv64.deb ... Unpacking libgomp1:riscv64 (12-20220319-1ubuntu1) over (11.2.0-7ubuntu2) ... Preparing to unpack .../27-libatomic1_12-20220319-1ubuntu1_riscv64.deb ... Unpacking libatomic1:riscv64 (12-20220319-1ubuntu1) over (11.2.0-7ubuntu2) ... Selecting previously unselected package libasan8:riscv64. Preparing to unpack .../28-libasan8_12-20220319-1ubuntu1_riscv64.deb ... Unpacking libasan8:riscv64 (12-20220319-1ubuntu1) ... Selecting previously unselected package libgcc-12-dev:riscv64. Preparing to unpack .../29-libgcc-12-dev_12-20220319-1ubuntu1_riscv64.deb ... Unpacking libgcc-12-dev:riscv64 (12-20220319-1ubuntu1) ... Selecting previously unselected package gcc-12. Preparing to unpack .../30-gcc-12_12-20220319-1ubuntu1_riscv64.deb ... Unpacking gcc-12 (12-20220319-1ubuntu1) ... Selecting previously unselected package libstdc++-12-dev:riscv64. Preparing to unpack .../31-libstdc++-12-dev_12-20220319-1ubuntu1_riscv64.deb ... Unpacking libstdc++-12-dev:riscv64 (12-20220319-1ubuntu1) ... Selecting previously unselected package g++-12. Preparing to unpack .../32-g++-12_12-20220319-1ubuntu1_riscv64.deb ... Unpacking g++-12 (12-20220319-1ubuntu1) ... Preparing to unpack .../33-make_4.3-4.1build1_riscv64.deb ... Unpacking make (4.3-4.1build1) over (4.3-4ubuntu1) ... Preparing to unpack .../34-dpkg-dev_1.21.1ubuntu11_all.deb ... Unpacking dpkg-dev (1.21.1ubuntu11) over (1.20.9ubuntu2) ... Preparing to unpack .../35-libdpkg-perl_1.21.1ubuntu11_all.deb ... Unpacking libdpkg-perl (1.21.1ubuntu11) over (1.20.9ubuntu2) ... Preparing to unpack .../36-patch_2.7.6-7build2_riscv64.deb ... Unpacking patch (2.7.6-7build2) over (2.7.6-7build1) ... Preparing to unpack .../37-lto-disabled-list_24_all.deb ... Unpacking lto-disabled-list (24) over (16) ... Selecting previously unselected package python3-psutil. Preparing to unpack .../38-python3-psutil_5.9.0-1build1_riscv64.deb ... Unpacking python3-psutil (5.9.0-1build1) ... Preparing to unpack .../39-build-essential_12.9ubuntu3_riscv64.deb ... Unpacking build-essential (12.9ubuntu3) over (12.9ubuntu2) ... Preparing to unpack .../40-libasan6_11.2.0-19ubuntu1_riscv64.deb ... Unpacking libasan6:riscv64 (11.2.0-19ubuntu1) over (11.2.0-7ubuntu2) ... Preparing to unpack .../41-g++-11_11.2.0-19ubuntu1_riscv64.deb ... Unpacking g++-11 (11.2.0-19ubuntu1) over (11.2.0-7ubuntu2) ... Preparing to unpack .../42-gcc-11_11.2.0-19ubuntu1_riscv64.deb ... Unpacking gcc-11 (11.2.0-19ubuntu1) over (11.2.0-7ubuntu2) ... Preparing to unpack .../43-libstdc++-11-dev_11.2.0-19ubuntu1_riscv64.deb ... Unpacking libstdc++-11-dev:riscv64 (11.2.0-19ubuntu1) over (11.2.0-7ubuntu2) ... Preparing to unpack .../44-libgcc-11-dev_11.2.0-19ubuntu1_riscv64.deb ... Unpacking libgcc-11-dev:riscv64 (11.2.0-19ubuntu1) over (11.2.0-7ubuntu2) ... Preparing to unpack .../45-cpp-11_11.2.0-19ubuntu1_riscv64.deb ... Unpacking cpp-11 (11.2.0-19ubuntu1) over (11.2.0-7ubuntu2) ... Preparing to unpack .../46-gcc-11-base_11.2.0-19ubuntu1_riscv64.deb ... Unpacking gcc-11-base:riscv64 (11.2.0-19ubuntu1) over (11.2.0-7ubuntu2) ... Preparing to unpack .../47-libfakeroot_1.28-1ubuntu1_riscv64.deb ... Unpacking libfakeroot:riscv64 (1.28-1ubuntu1) over (1.25.3-1.1ubuntu3) ... Preparing to unpack .../48-fakeroot_1.28-1ubuntu1_riscv64.deb ... Unpacking fakeroot (1.28-1ubuntu1) over (1.25.3-1.1ubuntu3) ... Preparing to unpack .../49-libassuan0_2.5.5-1build1_riscv64.deb ... Unpacking libassuan0:riscv64 (2.5.5-1build1) over (2.5.5-1) ... Preparing to unpack .../50-pinentry-curses_1.1.1-1build2_riscv64.deb ... Unpacking pinentry-curses (1.1.1-1build2) over (1.1.1-1build1) ... Preparing to unpack .../51-libnpth0_1.6-3build2_riscv64.deb ... Unpacking libnpth0:riscv64 (1.6-3build2) over (1.6-3build1) ... Preparing to unpack .../52-gpg_2.2.27-3ubuntu2_riscv64.deb ... Unpacking gpg (2.2.27-3ubuntu2) over (2.2.20-1ubuntu4) ... Preparing to unpack .../53-gpgconf_2.2.27-3ubuntu2_riscv64.deb ... Unpacking gpgconf (2.2.27-3ubuntu2) over (2.2.20-1ubuntu4) ... Preparing to unpack .../54-gpg-agent_2.2.27-3ubuntu2_riscv64.deb ... Unpacking gpg-agent (2.2.27-3ubuntu2) over (2.2.20-1ubuntu4) ... Preparing to unpack .../55-liblockfile-bin_1.17-1build2_riscv64.deb ... Unpacking liblockfile-bin (1.17-1build2) over (1.17-1build1) ... Preparing to unpack .../56-liblockfile1_1.17-1build2_riscv64.deb ... Unpacking liblockfile1:riscv64 (1.17-1build2) over (1.17-1build1) ... Preparing to unpack .../57-lockfile-progs_0.1.19build1_riscv64.deb ... Unpacking lockfile-progs (0.1.19build1) over (0.1.18build1) ... Preparing to unpack .../58-optipng_0.7.7-2build1_riscv64.deb ... Unpacking optipng (0.7.7-2build1) over (0.7.7-2) ... Preparing to unpack .../59-pkgbinarymangler_149_all.deb ... Unpacking pkgbinarymangler (149) over (148) ... Setting up media-types (7.0.0) ... Setting up gcc-11-base:riscv64 (11.2.0-19ubuntu1) ... Setting up lto-disabled-list (24) ... Setting up liblockfile-bin (1.17-1build2) ... Setting up init (1.62) ... Setting up libsqlite3-0:riscv64 (3.37.2-2) ... Setting up binutils-common:riscv64 (2.38-3ubuntu1) ... Setting up linux-libc-dev:riscv64 (5.15.0-25.25) ... Setting up libctf-nobfd0:riscv64 (2.38-3ubuntu1) ... Setting up libnpth0:riscv64 (1.6-3build2) ... Setting up libassuan0:riscv64 (2.5.5-1build1) ... Setting up libgomp1:riscv64 (12-20220319-1ubuntu1) ... Setting up perl-modules-5.34 (5.34.0-3ubuntu1) ... Setting up bzip2 (1.0.8-5build1) ... Setting up libfakeroot:riscv64 (1.28-1ubuntu1) ... Setting up libasan6:riscv64 (11.2.0-19ubuntu1) ... Setting up tzdata (2022a-0ubuntu1) ... Current default time zone: 'Etc/UTC' Local time is now: Sat Apr 23 01:07:12 UTC 2022. Universal Time is now: Sat Apr 23 01:07:12 UTC 2022. Run 'dpkg-reconfigure tzdata' if you wish to change it. Setting up fakeroot (1.28-1ubuntu1) ... Setting up libtirpc-dev:riscv64 (1.3.2-2build1) ... Setting up rpcsvc-proto (1.4.2-0ubuntu6) ... Setting up make (4.3-4.1build1) ... Setting up libmpfr6:riscv64 (4.1.0-3build3) ... Setting up libncurses6:riscv64 (6.3-2) ... Setting up xz-utils (5.2.5-2ubuntu1) ... Setting up libpng16-16:riscv64 (1.6.37-3build5) ... Setting up libmpc3:riscv64 (1.2.1-2build1) ... Setting up systemd-timesyncd (249.11-0ubuntu3) ... Setting up libatomic1:riscv64 (12-20220319-1ubuntu1) ... Setting up usrmerge (25ubuntu2) ... Setting up patch (2.7.6-7build2) ... Setting up libss2:riscv64 (1.46.5-2ubuntu1) ... Setting up libncursesw6:riscv64 (6.3-2) ... Setting up logsave (1.46.5-2ubuntu1) ... Setting up advancecomp (2.1-2.1ubuntu2) ... Setting up libgcc-11-dev:riscv64 (11.2.0-19ubuntu1) ... Setting up libnsl-dev:riscv64 (1.3.0-2build2) ... Setting up sensible-utils (0.0.17) ... Setting up libcrypt-dev:riscv64 (1:4.4.27-1) ... Setting up libasan8:riscv64 (12-20220319-1ubuntu1) ... Setting up libmpdec3:riscv64 (2.5.1-2build2) ... Setting up mawk (1.3.4.20200120-3) ... Setting up liblockfile1:riscv64 (1.17-1build2) ... Setting up libbinutils:riscv64 (2.38-3ubuntu1) ... Setting up libisl23:riscv64 (0.24-2build1) ... Setting up libc-dev-bin (2.35-0ubuntu3) ... Setting up openssl (3.0.2-0ubuntu1) ... Installing new version of config file /etc/ssl/openssl.cnf ... Setting up readline-common (8.1.2-1) ... Setting up libcc1-0:riscv64 (12-20220319-1ubuntu1) ... Setting up libprocps8:riscv64 (2:3.3.17-6ubuntu2) ... Setting up libgdbm6:riscv64 (1.23-1) ... Setting up libctf0:riscv64 (2.38-3ubuntu1) ... Setting up pinentry-curses (1.1.1-1build2) ... Setting up cpp-11 (11.2.0-19ubuntu1) ... Setting up cpp-12 (12-20220319-1ubuntu1) ... Setting up libreadline8:riscv64 (8.1.2-1) ... Setting up binutils-riscv64-linux-gnu (2.38-3ubuntu1) ... Setting up e2fsprogs (1.46.5-2ubuntu1) ... Installing new version of config file /etc/mke2fs.conf ... Setting up binutils (2.38-3ubuntu1) ... Setting up libpython3.10-stdlib:riscv64 (3.10.4-3) ... Setting up ca-certificates (20211016) ... Updating certificates in /etc/ssl/certs... rehash: warning: skipping ca-certificates.crt,it does not contain exactly one certificate or CRL 7 added, 8 removed; done. Setting up optipng (0.7.7-2build1) ... Setting up libgcc-12-dev:riscv64 (12-20220319-1ubuntu1) ... Setting up lockfile-progs (0.1.19build1) ... Setting up libgdbm-compat4:riscv64 (1.23-1) ... Setting up gcc-11 (11.2.0-19ubuntu1) ... Setting up cpp (4:12-20211211-1ubuntu2) ... Setting up procps (2:3.3.17-6ubuntu2) ... Installing new version of config file /etc/init.d/procps ... Installing new version of config file /etc/sysctl.d/README.sysctl ... Setting up gpgconf (2.2.27-3ubuntu2) ... Setting up libc6-dev:riscv64 (2.35-0ubuntu3) ... Setting up gpg (2.2.27-3ubuntu2) ... Setting up libpython3-stdlib:riscv64 (3.10.4-0ubuntu2) ... Setting up libperl5.34:riscv64 (5.34.0-3ubuntu1) ... Setting up gpg-agent (2.2.27-3ubuntu2) ... Setting up python3.10 (3.10.4-3) ... Setting up pkgbinarymangler (149) ... Setting up libstdc++-12-dev:riscv64 (12-20220319-1ubuntu1) ... Setting up python3 (3.10.4-0ubuntu2) ... Setting up python3-psutil (5.9.0-1build1) ... Setting up perl (5.34.0-3ubuntu1) ... Setting up gcc-12 (12-20220319-1ubuntu1) ... Setting up libdpkg-perl (1.21.1ubuntu11) ... Setting up libstdc++-11-dev:riscv64 (11.2.0-19ubuntu1) ... Setting up g++-12 (12-20220319-1ubuntu1) ... Setting up g++-11 (11.2.0-19ubuntu1) ... Setting up gcc (4:12-20211211-1ubuntu2) ... Setting up dpkg-dev (1.21.1ubuntu11) ... Setting up g++ (4:12-20211211-1ubuntu2) ... Setting up build-essential (12.9ubuntu3) ... Processing triggers for libc-bin (2.35-0ubuntu3) ... Processing triggers for ca-certificates (20211016) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. RUN: /usr/share/launchpad-buildd/bin/sbuild-package PACKAGEBUILD-23475775 riscv64 jammy -c chroot:build-PACKAGEBUILD-23475775 --arch=riscv64 --dist=jammy --nolog wise_2.4.1-23.dsc Initiating build PACKAGEBUILD-23475775 with 8 jobs across 8 processor cores. Kernel reported to sbuild: 5.13.0-1019-generic #21~20.04.1-Ubuntu SMP Thu Mar 24 22:36:01 UTC 2022 riscv64 sbuild (Debian sbuild) 0.79.0 (05 February 2020) on riscv64-qemu-lcy01-030.buildd +==============================================================================+ | wise 2.4.1-23 (riscv64) Sat, 23 Apr 2022 01:10:13 +0000 | +==============================================================================+ Package: wise Version: 2.4.1-23 Source Version: 2.4.1-23 Distribution: jammy Machine Architecture: riscv64 Host Architecture: riscv64 Build Architecture: riscv64 Build Type: any I: NOTICE: Log filtering will replace 'home/buildd/build-PACKAGEBUILD-23475775/chroot-autobuild' with '<>' I: NOTICE: Log filtering will replace 'build/wise-kESTaq/resolver-m4zcVK' with '<>' +------------------------------------------------------------------------------+ | Fetch source files | +------------------------------------------------------------------------------+ Local sources ------------- wise_2.4.1-23.dsc exists in .; copying to chroot I: NOTICE: Log filtering will replace 'build/wise-kESTaq/wise-2.4.1' with '<>' I: NOTICE: Log filtering will replace 'build/wise-kESTaq' with '<>' +------------------------------------------------------------------------------+ | Install package build dependencies | +------------------------------------------------------------------------------+ Setup apt archive ----------------- Merged Build-Depends: debhelper-compat (= 12), texlive-latex-base, texlive-extra-utils, hevea, docbook-to-man, libglib2.0-dev, build-essential, fakeroot Filtered Build-Depends: debhelper-compat (= 12), texlive-latex-base, texlive-extra-utils, hevea, docbook-to-man, libglib2.0-dev, build-essential, fakeroot dpkg-deb: building package 'sbuild-build-depends-main-dummy' in '/<>/apt_archive/sbuild-build-depends-main-dummy.deb'. Ign:1 copy:/<>/apt_archive ./ InRelease Get:2 copy:/<>/apt_archive ./ Release [957 B] Ign:3 copy:/<>/apt_archive ./ Release.gpg Get:4 copy:/<>/apt_archive ./ Sources [418 B] Get:5 copy:/<>/apt_archive ./ Packages [499 B] Fetched 1874 B in 1s (2490 B/s) Reading package lists... Reading package lists... Install main build dependencies (apt-based resolver) ---------------------------------------------------- Installing build dependencies Reading package lists... Building dependency tree... Reading state information... The following packages were automatically installed and are no longer required: g++-11 libperl5.32 libstdc++-11-dev perl-modules-5.32 systemd-timesyncd Use 'apt autoremove' to remove them. The following additional packages will be installed: autoconf automake autopoint autotools-dev bsdextrautils debhelper debugedit dh-autoreconf dh-strip-nondeterminism docbook docbook-to-man dwz file fontconfig-config fonts-dejavu-core fonts-lmodern fonts-urw-base35 gettext gettext-base ghostscript groff-base hevea intltool-debian libarchive-zip-perl libavahi-client3 libavahi-common-data libavahi-common3 libblkid-dev libbrotli1 libbsd0 libcairo2 libcups2 libdatrie1 libdbus-1-3 libdebhelper-perl libdeflate0 libdw1 libelf1 libffi-dev libfile-stripnondeterminism-perl libfontconfig1 libfontenc1 libfreetype6 libglib2.0-0 libglib2.0-bin libglib2.0-data libglib2.0-dev libglib2.0-dev-bin libgraphite2-3 libgs9 libgs9-common libharfbuzz0b libice6 libicu70 libidn12 libijs-0.35 libjbig0 libjbig2dec0 libjpeg-turbo8 libjpeg8 libjs-jquery libkpathsea6 libmagic-mgc libmagic1 libmd0 libmime-charset-perl libmount-dev libnetpbm10 libopenjp2-7 libosp5 libpaper-utils libpaper1 libpcre16-3 libpcre2-16-0 libpcre2-32-0 libpcre2-dev libpcre2-posix3 libpcre3-dev libpcre32-3 libpcrecpp0v5 libpipeline1 libpixman-1-0 libptexenc1 libselinux1-dev libsepol-dev libsigsegv2 libsm6 libsombok3 libsub-override-perl libsynctex2 libteckit0 libtexlua53 libthai-data libthai0 libtiff5 libtool libuchardet0 libunicode-linebreak-perl libwebp7 libx11-6 libx11-data libxau6 libxaw7 libxcb-render0 libxcb-shm0 libxcb1 libxdmcp6 libxext6 libxi6 libxml2 libxmu6 libxpm4 libxrender1 libxt6 libzzip-0-13 lmodern m4 man-db netpbm opensp pkg-config po-debconf poppler-data python3-distutils python3-lib2to3 sgml-base sgml-data t1utils tex-common texlive-base texlive-binaries texlive-extra-utils texlive-latex-base texlive-luatex texlive-plain-generic ucf uuid-dev x11-common xdg-utils xfonts-encodings xfonts-utils xml-core zlib1g-dev Suggested packages: autoconf-archive gnu-standards autoconf-doc dh-make docbook-defguide docbook-dsssl docbook-xml psgml fonts-freefont-otf | fonts-freefont-ttf fonts-texgyre gettext-doc libasprintf-dev libgettextpo-dev ghostscript-x groff hevea-doc texlive-latex-extra cups-common libgirepository1.0-dev libglib2.0-doc libgdk-pixbuf2.0-bin | libgdk-pixbuf2.0-dev libxml2-utils libencode-hanextra-perl libpod2-base-perl libtool-doc gfortran | fortran95-compiler gcj-jdk m4-doc apparmor less www-browser doc-base libmail-box-perl poppler-utils fonts-japanese-mincho | fonts-ipafont-mincho fonts-japanese-gothic | fonts-ipafont-gothic fonts-arphic-ukai fonts-arphic-uming fonts-nanum sgml-base-doc perlsgml w3-recs perl-tk xpdf | pdf-viewer xzdec chktex default-jre-headless dvidvi dvipng fragmaster lacheck latexdiff latexmk purifyeps xindy texlive-latex-base-doc Recommended packages: curl | wget | lynx dbus libarchive-cpio-perl shared-mime-info xdg-user-dirs fonts-droid-fallback javascript-common libltdl-dev libmail-sendmail-perl dvisvgm libfile-homedir-perl liblog-log4perl-perl libyaml-tiny-perl ruby texlive-latex-recommended libfile-mimeinfo-perl libnet-dbus-perl libx11-protocol-perl x11-utils x11-xserver-utils The following NEW packages will be installed: autoconf automake autopoint autotools-dev bsdextrautils debhelper debugedit dh-autoreconf dh-strip-nondeterminism docbook docbook-to-man dwz file fontconfig-config fonts-dejavu-core fonts-lmodern fonts-urw-base35 gettext gettext-base ghostscript groff-base hevea intltool-debian libarchive-zip-perl libavahi-client3 libavahi-common-data libavahi-common3 libblkid-dev libbrotli1 libbsd0 libcairo2 libcups2 libdatrie1 libdbus-1-3 libdebhelper-perl libdeflate0 libdw1 libelf1 libffi-dev libfile-stripnondeterminism-perl libfontconfig1 libfontenc1 libfreetype6 libglib2.0-0 libglib2.0-bin libglib2.0-data libglib2.0-dev libglib2.0-dev-bin libgraphite2-3 libgs9 libgs9-common libharfbuzz0b libice6 libicu70 libidn12 libijs-0.35 libjbig0 libjbig2dec0 libjpeg-turbo8 libjpeg8 libjs-jquery libkpathsea6 libmagic-mgc libmagic1 libmd0 libmime-charset-perl libmount-dev libnetpbm10 libopenjp2-7 libosp5 libpaper-utils libpaper1 libpcre16-3 libpcre2-16-0 libpcre2-32-0 libpcre2-dev libpcre2-posix3 libpcre3-dev libpcre32-3 libpcrecpp0v5 libpipeline1 libpixman-1-0 libptexenc1 libselinux1-dev libsepol-dev libsigsegv2 libsm6 libsombok3 libsub-override-perl libsynctex2 libteckit0 libtexlua53 libthai-data libthai0 libtiff5 libtool libuchardet0 libunicode-linebreak-perl libwebp7 libx11-6 libx11-data libxau6 libxaw7 libxcb-render0 libxcb-shm0 libxcb1 libxdmcp6 libxext6 libxi6 libxml2 libxmu6 libxpm4 libxrender1 libxt6 libzzip-0-13 lmodern m4 man-db netpbm opensp pkg-config po-debconf poppler-data python3-distutils python3-lib2to3 sbuild-build-depends-main-dummy sgml-base sgml-data t1utils tex-common texlive-base texlive-binaries texlive-extra-utils texlive-latex-base texlive-luatex texlive-plain-generic ucf uuid-dev x11-common xdg-utils xfonts-encodings xfonts-utils xml-core zlib1g-dev 0 upgraded, 144 newly installed, 0 to remove and 0 not upgraded. Need to get 196 MB of archives. After this operation, 523 MB of additional disk space will be used. Get:1 copy:/<>/apt_archive ./ sbuild-build-depends-main-dummy 0.invalid.0 [720 B] Get:2 http://ftpmaster.internal/ubuntu jammy/main riscv64 poppler-data all 0.4.11-1 [2171 kB] Get:3 http://ftpmaster.internal/ubuntu jammy/main riscv64 sgml-base all 1.30 [12.5 kB] Get:4 http://ftpmaster.internal/ubuntu jammy/main riscv64 ucf all 3.0043 [56.1 kB] Get:5 http://ftpmaster.internal/ubuntu jammy/universe riscv64 tex-common all 6.17 [33.7 kB] Get:6 http://ftpmaster.internal/ubuntu jammy/main riscv64 libmd0 riscv64 1.0.4-1build1 [30.1 kB] Get:7 http://ftpmaster.internal/ubuntu jammy/main riscv64 libbsd0 riscv64 0.11.5-1 [40.9 kB] Get:8 http://ftpmaster.internal/ubuntu jammy/main riscv64 libdbus-1-3 riscv64 1.12.20-2ubuntu4 [173 kB] Get:9 http://ftpmaster.internal/ubuntu jammy/main riscv64 libelf1 riscv64 0.186-1build1 [46.2 kB] Get:10 http://ftpmaster.internal/ubuntu jammy/main riscv64 libglib2.0-0 riscv64 2.72.1-1 [1310 kB] Get:11 http://ftpmaster.internal/ubuntu jammy/main riscv64 libglib2.0-data all 2.72.1-1 [4908 B] Get:12 http://ftpmaster.internal/ubuntu jammy/main riscv64 libicu70 riscv64 70.1-2 [10.5 MB] Get:13 http://ftpmaster.internal/ubuntu jammy/main riscv64 libxml2 riscv64 2.9.13+dfsg-1build1 [605 kB] Get:14 http://ftpmaster.internal/ubuntu jammy/main riscv64 bsdextrautils riscv64 2.37.2-4ubuntu3 [81.5 kB] Get:15 http://ftpmaster.internal/ubuntu jammy/main riscv64 libmagic-mgc riscv64 1:5.41-3 [257 kB] Get:16 http://ftpmaster.internal/ubuntu jammy/main riscv64 libmagic1 riscv64 1:5.41-3 [88.7 kB] Get:17 http://ftpmaster.internal/ubuntu jammy/main riscv64 file riscv64 1:5.41-3 [20.6 kB] Get:18 http://ftpmaster.internal/ubuntu jammy/main riscv64 gettext-base riscv64 0.21-4ubuntu4 [38.7 kB] Get:19 http://ftpmaster.internal/ubuntu jammy/main riscv64 libuchardet0 riscv64 0.0.7-1build2 [78.9 kB] Get:20 http://ftpmaster.internal/ubuntu jammy/main riscv64 groff-base riscv64 1.22.4-8build1 [925 kB] Get:21 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpipeline1 riscv64 1.5.5-1 [26.2 kB] Get:22 http://ftpmaster.internal/ubuntu jammy/main riscv64 libxau6 riscv64 1:1.0.9-1build5 [6836 B] Get:23 http://ftpmaster.internal/ubuntu jammy/main riscv64 libxdmcp6 riscv64 1:1.1.3-0ubuntu5 [10.3 kB] Get:24 http://ftpmaster.internal/ubuntu jammy/main riscv64 libxcb1 riscv64 1.14-3ubuntu3 [42.6 kB] Get:25 http://ftpmaster.internal/ubuntu jammy/main riscv64 libx11-data all 2:1.7.5-1 [119 kB] Get:26 http://ftpmaster.internal/ubuntu jammy/main riscv64 libx11-6 riscv64 2:1.7.5-1 [621 kB] Get:27 http://ftpmaster.internal/ubuntu jammy/main riscv64 libxext6 riscv64 2:1.3.4-1build1 [27.8 kB] Get:28 http://ftpmaster.internal/ubuntu jammy/main riscv64 man-db riscv64 2.10.2-1 [1144 kB] Get:29 http://ftpmaster.internal/ubuntu jammy/main riscv64 libsigsegv2 riscv64 2.13-1ubuntu3 [13.6 kB] Get:30 http://ftpmaster.internal/ubuntu jammy/main riscv64 m4 riscv64 1.4.18-5ubuntu2 [193 kB] Get:31 http://ftpmaster.internal/ubuntu jammy/main riscv64 autoconf all 2.71-2 [338 kB] Get:32 http://ftpmaster.internal/ubuntu jammy/main riscv64 autotools-dev all 20220109.1 [44.9 kB] Get:33 http://ftpmaster.internal/ubuntu jammy/main riscv64 automake all 1:1.16.5-1.3 [558 kB] Get:34 http://ftpmaster.internal/ubuntu jammy/main riscv64 autopoint all 0.21-4ubuntu4 [422 kB] Get:35 http://ftpmaster.internal/ubuntu jammy/main riscv64 libdebhelper-perl all 13.6ubuntu1 [67.2 kB] Get:36 http://ftpmaster.internal/ubuntu jammy/main riscv64 libtool all 2.4.6-15build2 [164 kB] Get:37 http://ftpmaster.internal/ubuntu jammy/main riscv64 dh-autoreconf all 20 [16.1 kB] Get:38 http://ftpmaster.internal/ubuntu jammy/main riscv64 libarchive-zip-perl all 1.68-1 [90.2 kB] Get:39 http://ftpmaster.internal/ubuntu jammy/main riscv64 libsub-override-perl all 0.09-2 [9532 B] Get:40 http://ftpmaster.internal/ubuntu jammy/main riscv64 libfile-stripnondeterminism-perl all 1.13.0-1 [18.1 kB] Get:41 http://ftpmaster.internal/ubuntu jammy/main riscv64 dh-strip-nondeterminism all 1.13.0-1 [5344 B] Get:42 http://ftpmaster.internal/ubuntu jammy/main riscv64 libdw1 riscv64 0.186-1build1 [229 kB] Get:43 http://ftpmaster.internal/ubuntu jammy/main riscv64 debugedit riscv64 1:5.0-4build1 [50.0 kB] Get:44 http://ftpmaster.internal/ubuntu jammy/main riscv64 dwz riscv64 0.14-1build2 [105 kB] Get:45 http://ftpmaster.internal/ubuntu jammy/main riscv64 gettext riscv64 0.21-4ubuntu4 [817 kB] Get:46 http://ftpmaster.internal/ubuntu jammy/main riscv64 intltool-debian all 0.35.0+20060710.5 [24.9 kB] Get:47 http://ftpmaster.internal/ubuntu jammy/main riscv64 po-debconf all 1.0.21+nmu1 [233 kB] Get:48 http://ftpmaster.internal/ubuntu jammy/main riscv64 debhelper all 13.6ubuntu1 [923 kB] Get:49 http://ftpmaster.internal/ubuntu jammy/main riscv64 xml-core all 0.18+nmu1 [21.6 kB] Get:50 http://ftpmaster.internal/ubuntu jammy/main riscv64 sgml-data all 2.0.11+nmu1 [171 kB] Get:51 http://ftpmaster.internal/ubuntu jammy/universe riscv64 docbook all 4.5-9 [120 kB] Get:52 http://ftpmaster.internal/ubuntu jammy/universe riscv64 libosp5 riscv64 1.5.2-13ubuntu3 [630 kB] Get:53 http://ftpmaster.internal/ubuntu jammy/universe riscv64 opensp riscv64 1.5.2-13ubuntu3 [140 kB] Get:54 http://ftpmaster.internal/ubuntu jammy/universe riscv64 docbook-to-man riscv64 1:2.0.0-45 [71.5 kB] Get:55 http://ftpmaster.internal/ubuntu jammy/main riscv64 fonts-dejavu-core all 2.37-2build1 [1041 kB] Get:56 http://ftpmaster.internal/ubuntu jammy/main riscv64 fonts-urw-base35 all 20200910-1 [6367 kB] Get:57 http://ftpmaster.internal/ubuntu jammy/main riscv64 fontconfig-config all 2.13.1-4.2ubuntu5 [29.1 kB] Get:58 http://ftpmaster.internal/ubuntu jammy/universe riscv64 fonts-lmodern all 2.004.5-6.1 [4532 kB] Get:59 http://ftpmaster.internal/ubuntu jammy/main riscv64 libgs9-common all 9.55.0~dfsg1-0ubuntu5 [752 kB] Get:60 http://ftpmaster.internal/ubuntu jammy/main riscv64 libavahi-common-data riscv64 0.8-5ubuntu5 [23.9 kB] Get:61 http://ftpmaster.internal/ubuntu jammy/main riscv64 libavahi-common3 riscv64 0.8-5ubuntu5 [20.1 kB] Get:62 http://ftpmaster.internal/ubuntu jammy/main riscv64 libavahi-client3 riscv64 0.8-5ubuntu5 [24.7 kB] Get:63 http://ftpmaster.internal/ubuntu jammy/main riscv64 libcups2 riscv64 2.4.1op1-1ubuntu4 [243 kB] Get:64 http://ftpmaster.internal/ubuntu jammy/main riscv64 libbrotli1 riscv64 1.0.9-2build6 [330 kB] Get:65 http://ftpmaster.internal/ubuntu jammy/main riscv64 libfreetype6 riscv64 2.11.1+dfsg-1build1 [361 kB] Get:66 http://ftpmaster.internal/ubuntu jammy/main riscv64 libfontconfig1 riscv64 2.13.1-4.2ubuntu5 [117 kB] Get:67 http://ftpmaster.internal/ubuntu jammy/main riscv64 libidn12 riscv64 1.38-4build1 [60.0 kB] Get:68 http://ftpmaster.internal/ubuntu jammy/main riscv64 libijs-0.35 riscv64 0.35-15build2 [15.2 kB] Get:69 http://ftpmaster.internal/ubuntu jammy/main riscv64 libjbig2dec0 riscv64 0.19-3build2 [60.4 kB] Get:70 http://ftpmaster.internal/ubuntu jammy/main riscv64 libjpeg-turbo8 riscv64 2.1.2-0ubuntu1 [113 kB] Get:71 http://ftpmaster.internal/ubuntu jammy/main riscv64 libjpeg8 riscv64 8c-2ubuntu10 [2270 B] Get:72 http://ftpmaster.internal/ubuntu jammy/main riscv64 libopenjp2-7 riscv64 2.4.0-6 [159 kB] Get:73 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpaper1 riscv64 1.1.28build2 [12.9 kB] Get:74 http://ftpmaster.internal/ubuntu jammy/main riscv64 libdeflate0 riscv64 1.10-2 [68.0 kB] Get:75 http://ftpmaster.internal/ubuntu jammy/main riscv64 libjbig0 riscv64 2.1-3.1build3 [27.5 kB] Get:76 http://ftpmaster.internal/ubuntu jammy/main riscv64 libwebp7 riscv64 1.2.2-2 [162 kB] Get:77 http://ftpmaster.internal/ubuntu jammy/main riscv64 libtiff5 riscv64 4.3.0-6 [165 kB] Get:78 http://ftpmaster.internal/ubuntu jammy/main riscv64 libgs9 riscv64 9.55.0~dfsg1-0ubuntu5 [4771 kB] Get:79 http://ftpmaster.internal/ubuntu jammy/main riscv64 ghostscript riscv64 9.55.0~dfsg1-0ubuntu5 [49.6 kB] Get:80 http://ftpmaster.internal/ubuntu jammy/universe riscv64 libnetpbm10 riscv64 2:10.0-15.4 [51.1 kB] Get:81 http://ftpmaster.internal/ubuntu jammy/universe riscv64 netpbm riscv64 2:10.0-15.4 [941 kB] Get:82 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpaper-utils riscv64 1.1.28build2 [8254 B] Get:83 http://ftpmaster.internal/ubuntu jammy/main riscv64 libkpathsea6 riscv64 2021.20210626.59705-1build1 [56.3 kB] Get:84 http://ftpmaster.internal/ubuntu jammy/main riscv64 libptexenc1 riscv64 2021.20210626.59705-1build1 [37.1 kB] Get:85 http://ftpmaster.internal/ubuntu jammy/main riscv64 libsynctex2 riscv64 2021.20210626.59705-1build1 [49.8 kB] Get:86 http://ftpmaster.internal/ubuntu jammy/main riscv64 libtexlua53 riscv64 2021.20210626.59705-1build1 [103 kB] Get:87 http://ftpmaster.internal/ubuntu jammy/main riscv64 t1utils riscv64 1.41-4build2 [55.5 kB] Get:88 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpixman-1-0 riscv64 0.40.0-1build4 [165 kB] Get:89 http://ftpmaster.internal/ubuntu jammy/main riscv64 libxcb-render0 riscv64 1.14-3ubuntu3 [13.8 kB] Get:90 http://ftpmaster.internal/ubuntu jammy/main riscv64 libxcb-shm0 riscv64 1.14-3ubuntu3 [5256 B] Get:91 http://ftpmaster.internal/ubuntu jammy/main riscv64 libxrender1 riscv64 1:0.9.10-1build4 [17.2 kB] Get:92 http://ftpmaster.internal/ubuntu jammy/main riscv64 libcairo2 riscv64 1.16.0-5ubuntu2 [571 kB] Get:93 http://ftpmaster.internal/ubuntu jammy/main riscv64 libgraphite2-3 riscv64 1.3.14-1build2 [71.5 kB] Get:94 http://ftpmaster.internal/ubuntu jammy/main riscv64 libharfbuzz0b riscv64 2.7.4-1ubuntu3 [369 kB] Get:95 http://ftpmaster.internal/ubuntu jammy/universe riscv64 libteckit0 riscv64 2.5.11+ds1-1 [352 kB] Get:96 http://ftpmaster.internal/ubuntu jammy/main riscv64 x11-common all 1:7.7+23ubuntu2 [23.4 kB] Get:97 http://ftpmaster.internal/ubuntu jammy/main riscv64 libice6 riscv64 2:1.0.10-1build2 [37.3 kB] Get:98 http://ftpmaster.internal/ubuntu jammy/main riscv64 libsm6 riscv64 2:1.2.3-1build2 [15.3 kB] Get:99 http://ftpmaster.internal/ubuntu jammy/main riscv64 libxt6 riscv64 1:1.2.1-1 [150 kB] Get:100 http://ftpmaster.internal/ubuntu jammy/main riscv64 libxmu6 riscv64 2:1.1.3-3 [43.7 kB] Get:101 http://ftpmaster.internal/ubuntu jammy/main riscv64 libxpm4 riscv64 1:3.5.12-1build2 [33.2 kB] Get:102 http://ftpmaster.internal/ubuntu jammy/main riscv64 libxaw7 riscv64 2:1.0.14-1 [163 kB] Get:103 http://ftpmaster.internal/ubuntu jammy/main riscv64 libxi6 riscv64 2:1.8-1build1 [29.7 kB] Get:104 http://ftpmaster.internal/ubuntu jammy/universe riscv64 libzzip-0-13 riscv64 0.13.72+dfsg.1-1.1 [23.7 kB] Get:105 http://ftpmaster.internal/ubuntu jammy/universe riscv64 texlive-binaries riscv64 2021.20210626.59705-1build1 [8046 kB] Get:106 http://ftpmaster.internal/ubuntu jammy/main riscv64 xdg-utils all 1.1.3-4.1ubuntu1 [62.2 kB] Get:107 http://ftpmaster.internal/ubuntu jammy/universe riscv64 texlive-base all 2021.20220204-1 [21.0 MB] Get:108 http://ftpmaster.internal/ubuntu jammy/universe riscv64 hevea riscv64 2.35-1build1 [1935 kB] Get:109 http://ftpmaster.internal/ubuntu jammy/main riscv64 libdatrie1 riscv64 0.2.13-2 [17.8 kB] Get:110 http://ftpmaster.internal/ubuntu jammy/main riscv64 libfontenc1 riscv64 1:1.1.4-1build3 [13.2 kB] Get:111 http://ftpmaster.internal/ubuntu jammy/main riscv64 libglib2.0-bin riscv64 2.72.1-1 [73.9 kB] Get:112 http://ftpmaster.internal/ubuntu jammy/main riscv64 libffi-dev riscv64 3.4.2-4 [93.4 kB] Get:113 http://ftpmaster.internal/ubuntu jammy/main riscv64 python3-lib2to3 all 3.10.4-0ubuntu1 [76.2 kB] Get:114 http://ftpmaster.internal/ubuntu jammy/main riscv64 python3-distutils all 3.10.4-0ubuntu1 [138 kB] Get:115 http://ftpmaster.internal/ubuntu jammy/main riscv64 libglib2.0-dev-bin riscv64 2.72.1-1 [116 kB] Get:116 http://ftpmaster.internal/ubuntu jammy/main riscv64 uuid-dev riscv64 2.37.2-4ubuntu3 [52.3 kB] Get:117 http://ftpmaster.internal/ubuntu jammy/main riscv64 libblkid-dev riscv64 2.37.2-4ubuntu3 [451 kB] Get:118 http://ftpmaster.internal/ubuntu jammy/main riscv64 libsepol-dev riscv64 3.3-1build1 [1050 kB] Get:119 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpcre2-16-0 riscv64 10.39-3build1 [119 kB] Get:120 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpcre2-32-0 riscv64 10.39-3build1 [110 kB] Get:121 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpcre2-posix3 riscv64 10.39-3build1 [5574 B] Get:122 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpcre2-dev riscv64 10.39-3build1 [1185 kB] Get:123 http://ftpmaster.internal/ubuntu jammy/main riscv64 libselinux1-dev riscv64 3.3-1build2 [275 kB] Get:124 http://ftpmaster.internal/ubuntu jammy/main riscv64 libmount-dev riscv64 2.37.2-4ubuntu3 [14.5 kB] Get:125 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpcre16-3 riscv64 2:8.39-13build5 [87.3 kB] Get:126 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpcre32-3 riscv64 2:8.39-13build5 [81.0 kB] Get:127 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpcrecpp0v5 riscv64 2:8.39-13build5 [15.8 kB] Get:128 http://ftpmaster.internal/ubuntu jammy/main riscv64 libpcre3-dev riscv64 2:8.39-13build5 [915 kB] Get:129 http://ftpmaster.internal/ubuntu jammy/main riscv64 pkg-config riscv64 0.29.2-1ubuntu3 [46.2 kB] Get:130 http://ftpmaster.internal/ubuntu jammy/main riscv64 zlib1g-dev riscv64 1:1.2.11.dfsg-2ubuntu9 [241 kB] Get:131 http://ftpmaster.internal/ubuntu jammy/main riscv64 libglib2.0-dev riscv64 2.72.1-1 [4161 kB] Get:132 http://ftpmaster.internal/ubuntu jammy/main riscv64 libjs-jquery all 3.6.0+dfsg+~3.5.13-1 [321 kB] Get:133 http://ftpmaster.internal/ubuntu jammy/universe riscv64 libmime-charset-perl all 1.012.2-1 [30.9 kB] Get:134 http://ftpmaster.internal/ubuntu jammy/main riscv64 libthai-data all 0.1.29-1build1 [162 kB] Get:135 http://ftpmaster.internal/ubuntu jammy/main riscv64 libthai0 riscv64 0.1.29-1build1 [16.8 kB] Get:136 http://ftpmaster.internal/ubuntu jammy/universe riscv64 libsombok3 riscv64 2.4.0-2 [24.2 kB] Get:137 http://ftpmaster.internal/ubuntu jammy/universe riscv64 libunicode-linebreak-perl riscv64 0.0.20190101-1build3 [97.0 kB] Get:138 http://ftpmaster.internal/ubuntu jammy/main riscv64 xfonts-encodings all 1:1.0.5-0ubuntu2 [578 kB] Get:139 http://ftpmaster.internal/ubuntu jammy/main riscv64 xfonts-utils riscv64 1:7.7+6build2 [92.1 kB] Get:140 http://ftpmaster.internal/ubuntu jammy/universe riscv64 lmodern all 2.004.5-6.1 [9471 kB] Get:141 http://ftpmaster.internal/ubuntu jammy/universe riscv64 texlive-latex-base all 2021.20220204-1 [1128 kB] Get:142 http://ftpmaster.internal/ubuntu jammy/universe riscv64 texlive-luatex all 2021.20220204-1 [17.4 MB] Get:143 http://ftpmaster.internal/ubuntu jammy/universe riscv64 texlive-plain-generic all 2021.20220204-1 [27.5 MB] Get:144 http://ftpmaster.internal/ubuntu jammy/universe riscv64 texlive-extra-utils all 2021.20220204-1 [52.0 MB] debconf: delaying package configuration, since apt-utils is not installed Fetched 196 MB in 37s (5237 kB/s) Selecting previously unselected package poppler-data. (Reading database ... 17030 files and directories currently installed.) Preparing to unpack .../000-poppler-data_0.4.11-1_all.deb ... Unpacking poppler-data (0.4.11-1) ... Selecting previously unselected package sgml-base. Preparing to unpack .../001-sgml-base_1.30_all.deb ... Unpacking sgml-base (1.30) ... Selecting previously unselected package ucf. Preparing to unpack .../002-ucf_3.0043_all.deb ... Moving old data out of the way Unpacking ucf (3.0043) ... Selecting previously unselected package tex-common. Preparing to unpack .../003-tex-common_6.17_all.deb ... Unpacking tex-common (6.17) ... Selecting previously unselected package libmd0:riscv64. Preparing to unpack .../004-libmd0_1.0.4-1build1_riscv64.deb ... Unpacking libmd0:riscv64 (1.0.4-1build1) ... Selecting previously unselected package libbsd0:riscv64. Preparing to unpack .../005-libbsd0_0.11.5-1_riscv64.deb ... Unpacking libbsd0:riscv64 (0.11.5-1) ... Selecting previously unselected package libdbus-1-3:riscv64. Preparing to unpack .../006-libdbus-1-3_1.12.20-2ubuntu4_riscv64.deb ... Unpacking libdbus-1-3:riscv64 (1.12.20-2ubuntu4) ... Selecting previously unselected package libelf1:riscv64. Preparing to unpack .../007-libelf1_0.186-1build1_riscv64.deb ... Unpacking libelf1:riscv64 (0.186-1build1) ... Selecting previously unselected package libglib2.0-0:riscv64. Preparing to unpack .../008-libglib2.0-0_2.72.1-1_riscv64.deb ... Unpacking libglib2.0-0:riscv64 (2.72.1-1) ... Selecting previously unselected package libglib2.0-data. Preparing to unpack .../009-libglib2.0-data_2.72.1-1_all.deb ... Unpacking libglib2.0-data (2.72.1-1) ... Selecting previously unselected package libicu70:riscv64. Preparing to unpack .../010-libicu70_70.1-2_riscv64.deb ... Unpacking libicu70:riscv64 (70.1-2) ... Selecting previously unselected package libxml2:riscv64. Preparing to unpack .../011-libxml2_2.9.13+dfsg-1build1_riscv64.deb ... Unpacking libxml2:riscv64 (2.9.13+dfsg-1build1) ... Selecting previously unselected package bsdextrautils. Preparing to unpack .../012-bsdextrautils_2.37.2-4ubuntu3_riscv64.deb ... Unpacking bsdextrautils (2.37.2-4ubuntu3) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../013-libmagic-mgc_1%3a5.41-3_riscv64.deb ... Unpacking libmagic-mgc (1:5.41-3) ... Selecting previously unselected package libmagic1:riscv64. Preparing to unpack .../014-libmagic1_1%3a5.41-3_riscv64.deb ... Unpacking libmagic1:riscv64 (1:5.41-3) ... Selecting previously unselected package file. Preparing to unpack .../015-file_1%3a5.41-3_riscv64.deb ... Unpacking file (1:5.41-3) ... Selecting previously unselected package gettext-base. Preparing to unpack .../016-gettext-base_0.21-4ubuntu4_riscv64.deb ... Unpacking gettext-base (0.21-4ubuntu4) ... Selecting previously unselected package libuchardet0:riscv64. Preparing to unpack .../017-libuchardet0_0.0.7-1build2_riscv64.deb ... Unpacking libuchardet0:riscv64 (0.0.7-1build2) ... Selecting previously unselected package groff-base. Preparing to unpack .../018-groff-base_1.22.4-8build1_riscv64.deb ... Unpacking groff-base (1.22.4-8build1) ... Selecting previously unselected package libpipeline1:riscv64. Preparing to unpack .../019-libpipeline1_1.5.5-1_riscv64.deb ... Unpacking libpipeline1:riscv64 (1.5.5-1) ... Selecting previously unselected package libxau6:riscv64. Preparing to unpack .../020-libxau6_1%3a1.0.9-1build5_riscv64.deb ... Unpacking libxau6:riscv64 (1:1.0.9-1build5) ... Selecting previously unselected package libxdmcp6:riscv64. Preparing to unpack .../021-libxdmcp6_1%3a1.1.3-0ubuntu5_riscv64.deb ... Unpacking libxdmcp6:riscv64 (1:1.1.3-0ubuntu5) ... Selecting previously unselected package libxcb1:riscv64. Preparing to unpack .../022-libxcb1_1.14-3ubuntu3_riscv64.deb ... Unpacking libxcb1:riscv64 (1.14-3ubuntu3) ... Selecting previously unselected package libx11-data. Preparing to unpack .../023-libx11-data_2%3a1.7.5-1_all.deb ... Unpacking libx11-data (2:1.7.5-1) ... Selecting previously unselected package libx11-6:riscv64. Preparing to unpack .../024-libx11-6_2%3a1.7.5-1_riscv64.deb ... Unpacking libx11-6:riscv64 (2:1.7.5-1) ... Selecting previously unselected package libxext6:riscv64. Preparing to unpack .../025-libxext6_2%3a1.3.4-1build1_riscv64.deb ... Unpacking libxext6:riscv64 (2:1.3.4-1build1) ... Selecting previously unselected package man-db. Preparing to unpack .../026-man-db_2.10.2-1_riscv64.deb ... Unpacking man-db (2.10.2-1) ... Selecting previously unselected package libsigsegv2:riscv64. Preparing to unpack .../027-libsigsegv2_2.13-1ubuntu3_riscv64.deb ... Unpacking libsigsegv2:riscv64 (2.13-1ubuntu3) ... Selecting previously unselected package m4. Preparing to unpack .../028-m4_1.4.18-5ubuntu2_riscv64.deb ... Unpacking m4 (1.4.18-5ubuntu2) ... Selecting previously unselected package autoconf. Preparing to unpack .../029-autoconf_2.71-2_all.deb ... Unpacking autoconf (2.71-2) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../030-autotools-dev_20220109.1_all.deb ... Unpacking autotools-dev (20220109.1) ... Selecting previously unselected package automake. Preparing to unpack .../031-automake_1%3a1.16.5-1.3_all.deb ... Unpacking automake (1:1.16.5-1.3) ... Selecting previously unselected package autopoint. Preparing to unpack .../032-autopoint_0.21-4ubuntu4_all.deb ... Unpacking autopoint (0.21-4ubuntu4) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../033-libdebhelper-perl_13.6ubuntu1_all.deb ... Unpacking libdebhelper-perl (13.6ubuntu1) ... Selecting previously unselected package libtool. Preparing to unpack .../034-libtool_2.4.6-15build2_all.deb ... Unpacking libtool (2.4.6-15build2) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../035-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../036-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../037-libsub-override-perl_0.09-2_all.deb ... Unpacking libsub-override-perl (0.09-2) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../038-libfile-stripnondeterminism-perl_1.13.0-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.13.0-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../039-dh-strip-nondeterminism_1.13.0-1_all.deb ... Unpacking dh-strip-nondeterminism (1.13.0-1) ... Selecting previously unselected package libdw1:riscv64. Preparing to unpack .../040-libdw1_0.186-1build1_riscv64.deb ... Unpacking libdw1:riscv64 (0.186-1build1) ... Selecting previously unselected package debugedit. Preparing to unpack .../041-debugedit_1%3a5.0-4build1_riscv64.deb ... Unpacking debugedit (1:5.0-4build1) ... Selecting previously unselected package dwz. Preparing to unpack .../042-dwz_0.14-1build2_riscv64.deb ... Unpacking dwz (0.14-1build2) ... Selecting previously unselected package gettext. Preparing to unpack .../043-gettext_0.21-4ubuntu4_riscv64.deb ... Unpacking gettext (0.21-4ubuntu4) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../044-intltool-debian_0.35.0+20060710.5_all.deb ... Unpacking intltool-debian (0.35.0+20060710.5) ... Selecting previously unselected package po-debconf. Preparing to unpack .../045-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../046-debhelper_13.6ubuntu1_all.deb ... Unpacking debhelper (13.6ubuntu1) ... Selecting previously unselected package xml-core. Preparing to unpack .../047-xml-core_0.18+nmu1_all.deb ... Unpacking xml-core (0.18+nmu1) ... Selecting previously unselected package sgml-data. Preparing to unpack .../048-sgml-data_2.0.11+nmu1_all.deb ... Unpacking sgml-data (2.0.11+nmu1) ... Selecting previously unselected package docbook. Preparing to unpack .../049-docbook_4.5-9_all.deb ... Unpacking docbook (4.5-9) ... Selecting previously unselected package libosp5. Preparing to unpack .../050-libosp5_1.5.2-13ubuntu3_riscv64.deb ... Unpacking libosp5 (1.5.2-13ubuntu3) ... Selecting previously unselected package opensp. Preparing to unpack .../051-opensp_1.5.2-13ubuntu3_riscv64.deb ... Unpacking opensp (1.5.2-13ubuntu3) ... Selecting previously unselected package docbook-to-man. Preparing to unpack .../052-docbook-to-man_1%3a2.0.0-45_riscv64.deb ... Unpacking docbook-to-man (1:2.0.0-45) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../053-fonts-dejavu-core_2.37-2build1_all.deb ... Unpacking fonts-dejavu-core (2.37-2build1) ... Selecting previously unselected package fonts-urw-base35. Preparing to unpack .../054-fonts-urw-base35_20200910-1_all.deb ... Unpacking fonts-urw-base35 (20200910-1) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../055-fontconfig-config_2.13.1-4.2ubuntu5_all.deb ... Unpacking fontconfig-config (2.13.1-4.2ubuntu5) ... Selecting previously unselected package fonts-lmodern. Preparing to unpack .../056-fonts-lmodern_2.004.5-6.1_all.deb ... Unpacking fonts-lmodern (2.004.5-6.1) ... Selecting previously unselected package libgs9-common. Preparing to unpack .../057-libgs9-common_9.55.0~dfsg1-0ubuntu5_all.deb ... Unpacking libgs9-common (9.55.0~dfsg1-0ubuntu5) ... Selecting previously unselected package libavahi-common-data:riscv64. Preparing to unpack .../058-libavahi-common-data_0.8-5ubuntu5_riscv64.deb ... Unpacking libavahi-common-data:riscv64 (0.8-5ubuntu5) ... Selecting previously unselected package libavahi-common3:riscv64. Preparing to unpack .../059-libavahi-common3_0.8-5ubuntu5_riscv64.deb ... Unpacking libavahi-common3:riscv64 (0.8-5ubuntu5) ... Selecting previously unselected package libavahi-client3:riscv64. Preparing to unpack .../060-libavahi-client3_0.8-5ubuntu5_riscv64.deb ... Unpacking libavahi-client3:riscv64 (0.8-5ubuntu5) ... Selecting previously unselected package libcups2:riscv64. Preparing to unpack .../061-libcups2_2.4.1op1-1ubuntu4_riscv64.deb ... Unpacking libcups2:riscv64 (2.4.1op1-1ubuntu4) ... Selecting previously unselected package libbrotli1:riscv64. Preparing to unpack .../062-libbrotli1_1.0.9-2build6_riscv64.deb ... Unpacking libbrotli1:riscv64 (1.0.9-2build6) ... Selecting previously unselected package libfreetype6:riscv64. Preparing to unpack .../063-libfreetype6_2.11.1+dfsg-1build1_riscv64.deb ... Unpacking libfreetype6:riscv64 (2.11.1+dfsg-1build1) ... Selecting previously unselected package libfontconfig1:riscv64. Preparing to unpack .../064-libfontconfig1_2.13.1-4.2ubuntu5_riscv64.deb ... Unpacking libfontconfig1:riscv64 (2.13.1-4.2ubuntu5) ... Selecting previously unselected package libidn12:riscv64. Preparing to unpack .../065-libidn12_1.38-4build1_riscv64.deb ... Unpacking libidn12:riscv64 (1.38-4build1) ... Selecting previously unselected package libijs-0.35:riscv64. Preparing to unpack .../066-libijs-0.35_0.35-15build2_riscv64.deb ... Unpacking libijs-0.35:riscv64 (0.35-15build2) ... Selecting previously unselected package libjbig2dec0:riscv64. Preparing to unpack .../067-libjbig2dec0_0.19-3build2_riscv64.deb ... Unpacking libjbig2dec0:riscv64 (0.19-3build2) ... Selecting previously unselected package libjpeg-turbo8:riscv64. Preparing to unpack .../068-libjpeg-turbo8_2.1.2-0ubuntu1_riscv64.deb ... Unpacking libjpeg-turbo8:riscv64 (2.1.2-0ubuntu1) ... Selecting previously unselected package libjpeg8:riscv64. Preparing to unpack .../069-libjpeg8_8c-2ubuntu10_riscv64.deb ... Unpacking libjpeg8:riscv64 (8c-2ubuntu10) ... Selecting previously unselected package libopenjp2-7:riscv64. Preparing to unpack .../070-libopenjp2-7_2.4.0-6_riscv64.deb ... Unpacking libopenjp2-7:riscv64 (2.4.0-6) ... Selecting previously unselected package libpaper1:riscv64. Preparing to unpack .../071-libpaper1_1.1.28build2_riscv64.deb ... Unpacking libpaper1:riscv64 (1.1.28build2) ... Selecting previously unselected package libdeflate0:riscv64. Preparing to unpack .../072-libdeflate0_1.10-2_riscv64.deb ... Unpacking libdeflate0:riscv64 (1.10-2) ... Selecting previously unselected package libjbig0:riscv64. Preparing to unpack .../073-libjbig0_2.1-3.1build3_riscv64.deb ... Unpacking libjbig0:riscv64 (2.1-3.1build3) ... Selecting previously unselected package libwebp7:riscv64. Preparing to unpack .../074-libwebp7_1.2.2-2_riscv64.deb ... Unpacking libwebp7:riscv64 (1.2.2-2) ... Selecting previously unselected package libtiff5:riscv64. Preparing to unpack .../075-libtiff5_4.3.0-6_riscv64.deb ... Unpacking libtiff5:riscv64 (4.3.0-6) ... Selecting previously unselected package libgs9:riscv64. Preparing to unpack .../076-libgs9_9.55.0~dfsg1-0ubuntu5_riscv64.deb ... Unpacking libgs9:riscv64 (9.55.0~dfsg1-0ubuntu5) ... Selecting previously unselected package ghostscript. Preparing to unpack .../077-ghostscript_9.55.0~dfsg1-0ubuntu5_riscv64.deb ... Unpacking ghostscript (9.55.0~dfsg1-0ubuntu5) ... Selecting previously unselected package libnetpbm10. Preparing to unpack .../078-libnetpbm10_2%3a10.0-15.4_riscv64.deb ... Unpacking libnetpbm10 (2:10.0-15.4) ... Selecting previously unselected package netpbm. Preparing to unpack .../079-netpbm_2%3a10.0-15.4_riscv64.deb ... Unpacking netpbm (2:10.0-15.4) ... Selecting previously unselected package libpaper-utils. Preparing to unpack .../080-libpaper-utils_1.1.28build2_riscv64.deb ... Unpacking libpaper-utils (1.1.28build2) ... Selecting previously unselected package libkpathsea6:riscv64. Preparing to unpack .../081-libkpathsea6_2021.20210626.59705-1build1_riscv64.deb ... Unpacking libkpathsea6:riscv64 (2021.20210626.59705-1build1) ... Selecting previously unselected package libptexenc1:riscv64. Preparing to unpack .../082-libptexenc1_2021.20210626.59705-1build1_riscv64.deb ... Unpacking libptexenc1:riscv64 (2021.20210626.59705-1build1) ... Selecting previously unselected package libsynctex2:riscv64. Preparing to unpack .../083-libsynctex2_2021.20210626.59705-1build1_riscv64.deb ... Unpacking libsynctex2:riscv64 (2021.20210626.59705-1build1) ... Selecting previously unselected package libtexlua53:riscv64. Preparing to unpack .../084-libtexlua53_2021.20210626.59705-1build1_riscv64.deb ... Unpacking libtexlua53:riscv64 (2021.20210626.59705-1build1) ... Selecting previously unselected package t1utils. Preparing to unpack .../085-t1utils_1.41-4build2_riscv64.deb ... Unpacking t1utils (1.41-4build2) ... Selecting previously unselected package libpixman-1-0:riscv64. Preparing to unpack .../086-libpixman-1-0_0.40.0-1build4_riscv64.deb ... Unpacking libpixman-1-0:riscv64 (0.40.0-1build4) ... Selecting previously unselected package libxcb-render0:riscv64. Preparing to unpack .../087-libxcb-render0_1.14-3ubuntu3_riscv64.deb ... Unpacking libxcb-render0:riscv64 (1.14-3ubuntu3) ... Selecting previously unselected package libxcb-shm0:riscv64. Preparing to unpack .../088-libxcb-shm0_1.14-3ubuntu3_riscv64.deb ... Unpacking libxcb-shm0:riscv64 (1.14-3ubuntu3) ... Selecting previously unselected package libxrender1:riscv64. Preparing to unpack .../089-libxrender1_1%3a0.9.10-1build4_riscv64.deb ... Unpacking libxrender1:riscv64 (1:0.9.10-1build4) ... Selecting previously unselected package libcairo2:riscv64. Preparing to unpack .../090-libcairo2_1.16.0-5ubuntu2_riscv64.deb ... Unpacking libcairo2:riscv64 (1.16.0-5ubuntu2) ... Selecting previously unselected package libgraphite2-3:riscv64. Preparing to unpack .../091-libgraphite2-3_1.3.14-1build2_riscv64.deb ... Unpacking libgraphite2-3:riscv64 (1.3.14-1build2) ... Selecting previously unselected package libharfbuzz0b:riscv64. Preparing to unpack .../092-libharfbuzz0b_2.7.4-1ubuntu3_riscv64.deb ... Unpacking libharfbuzz0b:riscv64 (2.7.4-1ubuntu3) ... Selecting previously unselected package libteckit0:riscv64. Preparing to unpack .../093-libteckit0_2.5.11+ds1-1_riscv64.deb ... Unpacking libteckit0:riscv64 (2.5.11+ds1-1) ... Selecting previously unselected package x11-common. Preparing to unpack .../094-x11-common_1%3a7.7+23ubuntu2_all.deb ... Unpacking x11-common (1:7.7+23ubuntu2) ... Selecting previously unselected package libice6:riscv64. Preparing to unpack .../095-libice6_2%3a1.0.10-1build2_riscv64.deb ... Unpacking libice6:riscv64 (2:1.0.10-1build2) ... Selecting previously unselected package libsm6:riscv64. Preparing to unpack .../096-libsm6_2%3a1.2.3-1build2_riscv64.deb ... Unpacking libsm6:riscv64 (2:1.2.3-1build2) ... Selecting previously unselected package libxt6:riscv64. Preparing to unpack .../097-libxt6_1%3a1.2.1-1_riscv64.deb ... Unpacking libxt6:riscv64 (1:1.2.1-1) ... Selecting previously unselected package libxmu6:riscv64. Preparing to unpack .../098-libxmu6_2%3a1.1.3-3_riscv64.deb ... Unpacking libxmu6:riscv64 (2:1.1.3-3) ... Selecting previously unselected package libxpm4:riscv64. Preparing to unpack .../099-libxpm4_1%3a3.5.12-1build2_riscv64.deb ... Unpacking libxpm4:riscv64 (1:3.5.12-1build2) ... Selecting previously unselected package libxaw7:riscv64. Preparing to unpack .../100-libxaw7_2%3a1.0.14-1_riscv64.deb ... Unpacking libxaw7:riscv64 (2:1.0.14-1) ... Selecting previously unselected package libxi6:riscv64. Preparing to unpack .../101-libxi6_2%3a1.8-1build1_riscv64.deb ... Unpacking libxi6:riscv64 (2:1.8-1build1) ... Selecting previously unselected package libzzip-0-13:riscv64. Preparing to unpack .../102-libzzip-0-13_0.13.72+dfsg.1-1.1_riscv64.deb ... Unpacking libzzip-0-13:riscv64 (0.13.72+dfsg.1-1.1) ... Selecting previously unselected package texlive-binaries. Preparing to unpack .../103-texlive-binaries_2021.20210626.59705-1build1_riscv64.deb ... Unpacking texlive-binaries (2021.20210626.59705-1build1) ... Selecting previously unselected package xdg-utils. Preparing to unpack .../104-xdg-utils_1.1.3-4.1ubuntu1_all.deb ... Unpacking xdg-utils (1.1.3-4.1ubuntu1) ... Selecting previously unselected package texlive-base. Preparing to unpack .../105-texlive-base_2021.20220204-1_all.deb ... Unpacking texlive-base (2021.20220204-1) ... Selecting previously unselected package hevea. Preparing to unpack .../106-hevea_2.35-1build1_riscv64.deb ... Unpacking hevea (2.35-1build1) ... Selecting previously unselected package libdatrie1:riscv64. Preparing to unpack .../107-libdatrie1_0.2.13-2_riscv64.deb ... Unpacking libdatrie1:riscv64 (0.2.13-2) ... Selecting previously unselected package libfontenc1:riscv64. Preparing to unpack .../108-libfontenc1_1%3a1.1.4-1build3_riscv64.deb ... Unpacking libfontenc1:riscv64 (1:1.1.4-1build3) ... Selecting previously unselected package libglib2.0-bin. Preparing to unpack .../109-libglib2.0-bin_2.72.1-1_riscv64.deb ... Unpacking libglib2.0-bin (2.72.1-1) ... Selecting previously unselected package libffi-dev:riscv64. Preparing to unpack .../110-libffi-dev_3.4.2-4_riscv64.deb ... Unpacking libffi-dev:riscv64 (3.4.2-4) ... Selecting previously unselected package python3-lib2to3. Preparing to unpack .../111-python3-lib2to3_3.10.4-0ubuntu1_all.deb ... Unpacking python3-lib2to3 (3.10.4-0ubuntu1) ... Selecting previously unselected package python3-distutils. Preparing to unpack .../112-python3-distutils_3.10.4-0ubuntu1_all.deb ... Unpacking python3-distutils (3.10.4-0ubuntu1) ... Selecting previously unselected package libglib2.0-dev-bin. Preparing to unpack .../113-libglib2.0-dev-bin_2.72.1-1_riscv64.deb ... Unpacking libglib2.0-dev-bin (2.72.1-1) ... Selecting previously unselected package uuid-dev:riscv64. Preparing to unpack .../114-uuid-dev_2.37.2-4ubuntu3_riscv64.deb ... Unpacking uuid-dev:riscv64 (2.37.2-4ubuntu3) ... Selecting previously unselected package libblkid-dev:riscv64. Preparing to unpack .../115-libblkid-dev_2.37.2-4ubuntu3_riscv64.deb ... Unpacking libblkid-dev:riscv64 (2.37.2-4ubuntu3) ... Selecting previously unselected package libsepol-dev:riscv64. Preparing to unpack .../116-libsepol-dev_3.3-1build1_riscv64.deb ... Unpacking libsepol-dev:riscv64 (3.3-1build1) ... Selecting previously unselected package libpcre2-16-0:riscv64. Preparing to unpack .../117-libpcre2-16-0_10.39-3build1_riscv64.deb ... Unpacking libpcre2-16-0:riscv64 (10.39-3build1) ... Selecting previously unselected package libpcre2-32-0:riscv64. Preparing to unpack .../118-libpcre2-32-0_10.39-3build1_riscv64.deb ... Unpacking libpcre2-32-0:riscv64 (10.39-3build1) ... Selecting previously unselected package libpcre2-posix3:riscv64. Preparing to unpack .../119-libpcre2-posix3_10.39-3build1_riscv64.deb ... Unpacking libpcre2-posix3:riscv64 (10.39-3build1) ... Selecting previously unselected package libpcre2-dev:riscv64. Preparing to unpack .../120-libpcre2-dev_10.39-3build1_riscv64.deb ... Unpacking libpcre2-dev:riscv64 (10.39-3build1) ... Selecting previously unselected package libselinux1-dev:riscv64. Preparing to unpack .../121-libselinux1-dev_3.3-1build2_riscv64.deb ... Unpacking libselinux1-dev:riscv64 (3.3-1build2) ... Selecting previously unselected package libmount-dev:riscv64. Preparing to unpack .../122-libmount-dev_2.37.2-4ubuntu3_riscv64.deb ... Unpacking libmount-dev:riscv64 (2.37.2-4ubuntu3) ... Selecting previously unselected package libpcre16-3:riscv64. Preparing to unpack .../123-libpcre16-3_2%3a8.39-13build5_riscv64.deb ... Unpacking libpcre16-3:riscv64 (2:8.39-13build5) ... Selecting previously unselected package libpcre32-3:riscv64. Preparing to unpack .../124-libpcre32-3_2%3a8.39-13build5_riscv64.deb ... Unpacking libpcre32-3:riscv64 (2:8.39-13build5) ... Selecting previously unselected package libpcrecpp0v5:riscv64. Preparing to unpack .../125-libpcrecpp0v5_2%3a8.39-13build5_riscv64.deb ... Unpacking libpcrecpp0v5:riscv64 (2:8.39-13build5) ... Selecting previously unselected package libpcre3-dev:riscv64. Preparing to unpack .../126-libpcre3-dev_2%3a8.39-13build5_riscv64.deb ... Unpacking libpcre3-dev:riscv64 (2:8.39-13build5) ... Selecting previously unselected package pkg-config. Preparing to unpack .../127-pkg-config_0.29.2-1ubuntu3_riscv64.deb ... Unpacking pkg-config (0.29.2-1ubuntu3) ... Selecting previously unselected package zlib1g-dev:riscv64. Preparing to unpack .../128-zlib1g-dev_1%3a1.2.11.dfsg-2ubuntu9_riscv64.deb ... Unpacking zlib1g-dev:riscv64 (1:1.2.11.dfsg-2ubuntu9) ... Selecting previously unselected package libglib2.0-dev:riscv64. Preparing to unpack .../129-libglib2.0-dev_2.72.1-1_riscv64.deb ... Unpacking libglib2.0-dev:riscv64 (2.72.1-1) ... Selecting previously unselected package libjs-jquery. Preparing to unpack .../130-libjs-jquery_3.6.0+dfsg+~3.5.13-1_all.deb ... Unpacking libjs-jquery (3.6.0+dfsg+~3.5.13-1) ... Selecting previously unselected package libmime-charset-perl. Preparing to unpack .../131-libmime-charset-perl_1.012.2-1_all.deb ... Unpacking libmime-charset-perl (1.012.2-1) ... Selecting previously unselected package libthai-data. Preparing to unpack .../132-libthai-data_0.1.29-1build1_all.deb ... Unpacking libthai-data (0.1.29-1build1) ... Selecting previously unselected package libthai0:riscv64. Preparing to unpack .../133-libthai0_0.1.29-1build1_riscv64.deb ... Unpacking libthai0:riscv64 (0.1.29-1build1) ... Selecting previously unselected package libsombok3:riscv64. Preparing to unpack .../134-libsombok3_2.4.0-2_riscv64.deb ... Unpacking libsombok3:riscv64 (2.4.0-2) ... Selecting previously unselected package libunicode-linebreak-perl. Preparing to unpack .../135-libunicode-linebreak-perl_0.0.20190101-1build3_riscv64.deb ... Unpacking libunicode-linebreak-perl (0.0.20190101-1build3) ... Selecting previously unselected package xfonts-encodings. Preparing to unpack .../136-xfonts-encodings_1%3a1.0.5-0ubuntu2_all.deb ... Unpacking xfonts-encodings (1:1.0.5-0ubuntu2) ... Selecting previously unselected package xfonts-utils. Preparing to unpack .../137-xfonts-utils_1%3a7.7+6build2_riscv64.deb ... Unpacking xfonts-utils (1:7.7+6build2) ... Selecting previously unselected package lmodern. Preparing to unpack .../138-lmodern_2.004.5-6.1_all.deb ... Unpacking lmodern (2.004.5-6.1) ... Selecting previously unselected package texlive-latex-base. Preparing to unpack .../139-texlive-latex-base_2021.20220204-1_all.deb ... Unpacking texlive-latex-base (2021.20220204-1) ... Selecting previously unselected package texlive-luatex. Preparing to unpack .../140-texlive-luatex_2021.20220204-1_all.deb ... Unpacking texlive-luatex (2021.20220204-1) ... Selecting previously unselected package texlive-plain-generic. Preparing to unpack .../141-texlive-plain-generic_2021.20220204-1_all.deb ... Unpacking texlive-plain-generic (2021.20220204-1) ... Selecting previously unselected package texlive-extra-utils. Preparing to unpack .../142-texlive-extra-utils_2021.20220204-1_all.deb ... Unpacking texlive-extra-utils (2021.20220204-1) ... Selecting previously unselected package sbuild-build-depends-main-dummy. Preparing to unpack .../143-sbuild-build-depends-main-dummy_0.invalid.0_riscv64.deb ... Unpacking sbuild-build-depends-main-dummy (0.invalid.0) ... Setting up libpcrecpp0v5:riscv64 (2:8.39-13build5) ... Setting up libpipeline1:riscv64 (1.5.5-1) ... Setting up libgraphite2-3:riscv64 (1.3.14-1build2) ... Setting up libpixman-1-0:riscv64 (0.40.0-1build4) ... Setting up libxau6:riscv64 (1:1.0.9-1build5) ... Setting up bsdextrautils (2.37.2-4ubuntu3) ... update-alternatives: using /usr/bin/write.ul to provide /usr/bin/write (write) in auto mode Setting up libpcre16-3:riscv64 (2:8.39-13build5) ... Setting up libdatrie1:riscv64 (0.2.13-2) ... Setting up libmagic-mgc (1:5.41-3) ... Setting up libtexlua53:riscv64 (2021.20210626.59705-1build1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libglib2.0-0:riscv64 (2.72.1-1) ... No schema files found: doing nothing. Setting up libijs-0.35:riscv64 (0.35-15build2) ... Setting up libdebhelper-perl (13.6ubuntu1) ... Setting up libbrotli1:riscv64 (1.0.9-2build6) ... Setting up x11-common (1:7.7+23ubuntu2) ... Running in chroot, ignoring request. invoke-rc.d: policy-rc.d denied execution of start. Setting up libmagic1:riscv64 (1:5.41-3) ... Setting up libdeflate0:riscv64 (1.10-2) ... Setting up gettext-base (0.21-4ubuntu4) ... Setting up libzzip-0-13:riscv64 (0.13.72+dfsg.1-1.1) ... Setting up file (1:5.41-3) ... Setting up libnetpbm10 (2:10.0-15.4) ... Setting up fonts-urw-base35 (20200910-1) ... Setting up libffi-dev:riscv64 (3.4.2-4) ... Setting up libjbig0:riscv64 (2.1-3.1build3) ... Setting up libpcre2-16-0:riscv64 (10.39-3build1) ... Setting up poppler-data (0.4.11-1) ... Setting up libosp5 (1.5.2-13ubuntu3) ... Setting up libfontenc1:riscv64 (1:1.1.4-1build3) ... Setting up autotools-dev (20220109.1) ... Setting up libpcre2-32-0:riscv64 (10.39-3build1) ... Setting up libglib2.0-data (2.72.1-1) ... Setting up libfreetype6:riscv64 (2.11.1+dfsg-1build1) ... Setting up libx11-data (2:1.7.5-1) ... Setting up libjbig2dec0:riscv64 (0.19-3build2) ... Setting up libteckit0:riscv64 (2.5.11+ds1-1) ... Setting up uuid-dev:riscv64 (2.37.2-4ubuntu3) ... Setting up libavahi-common-data:riscv64 (0.8-5ubuntu5) ... Setting up libdbus-1-3:riscv64 (1.12.20-2ubuntu4) ... Setting up libsigsegv2:riscv64 (2.13-1ubuntu3) ... Setting up xfonts-encodings (1:1.0.5-0ubuntu2) ... Setting up t1utils (1.41-4build2) ... Setting up libpcre32-3:riscv64 (2:8.39-13build5) ... Setting up libidn12:riscv64 (1.38-4build1) ... Setting up autopoint (0.21-4ubuntu4) ... Setting up pkg-config (0.29.2-1ubuntu3) ... Setting up fonts-dejavu-core (2.37-2build1) ... Setting up libsepol-dev:riscv64 (3.3-1build1) ... Setting up ucf (3.0043) ... Setting up libjpeg-turbo8:riscv64 (2.1.2-0ubuntu1) ... Setting up libkpathsea6:riscv64 (2021.20210626.59705-1build1) ... Setting up libwebp7:riscv64 (1.2.2-2) ... Setting up zlib1g-dev:riscv64 (1:1.2.11.dfsg-2ubuntu9) ... Setting up libpcre2-posix3:riscv64 (10.39-3build1) ... Setting up libmd0:riscv64 (1.0.4-1build1) ... Setting up libmime-charset-perl (1.012.2-1) ... Setting up libuchardet0:riscv64 (0.0.7-1build2) ... Setting up fonts-lmodern (2.004.5-6.1) ... Setting up libopenjp2-7:riscv64 (2.4.0-6) ... Setting up libsub-override-perl (0.09-2) ... Setting up libharfbuzz0b:riscv64 (2.7.4-1ubuntu3) ... Setting up libthai-data (0.1.29-1build1) ... Setting up sgml-base (1.30) ... Setting up libjs-jquery (3.6.0+dfsg+~3.5.13-1) ... Setting up libbsd0:riscv64 (0.11.5-1) ... Setting up python3-lib2to3 (3.10.4-0ubuntu1) ... Setting up libelf1:riscv64 (0.186-1build1) ... Setting up xdg-utils (1.1.3-4.1ubuntu1) ... update-alternatives: using /usr/bin/xdg-open to provide /usr/bin/open (open) in auto mode Setting up libsynctex2:riscv64 (2021.20210626.59705-1build1) ... Setting up libicu70:riscv64 (70.1-2) ... Setting up libjpeg8:riscv64 (8c-2ubuntu10) ... Setting up python3-distutils (3.10.4-0ubuntu1) ... Setting up libgs9-common (9.55.0~dfsg1-0ubuntu5) ... Setting up libfile-stripnondeterminism-perl (1.13.0-1) ... Setting up libglib2.0-dev-bin (2.72.1-1) ... Setting up libblkid-dev:riscv64 (2.37.2-4ubuntu3) ... Setting up libpaper1:riscv64 (1.1.28build2) ... Creating config file /etc/papersize with new version Setting up libice6:riscv64 (2:1.0.10-1build2) ... Setting up libdw1:riscv64 (0.186-1build1) ... Setting up libxdmcp6:riscv64 (1:1.1.3-0ubuntu5) ... Setting up libxcb1:riscv64 (1.14-3ubuntu3) ... Setting up libpcre2-dev:riscv64 (10.39-3build1) ... Setting up libtool (2.4.6-15build2) ... Setting up libxcb-render0:riscv64 (1.14-3ubuntu3) ... Setting up libselinux1-dev:riscv64 (3.3-1build2) ... Setting up libpcre3-dev:riscv64 (2:8.39-13build5) ... Setting up fontconfig-config (2.13.1-4.2ubuntu5) ... Setting up libavahi-common3:riscv64 (0.8-5ubuntu5) ... Setting up libglib2.0-bin (2.72.1-1) ... Setting up m4 (1.4.18-5ubuntu2) ... Setting up libxcb-shm0:riscv64 (1.14-3ubuntu3) ... Setting up libpaper-utils (1.1.28build2) ... Setting up opensp (1.5.2-13ubuntu3) ... Setting up xfonts-utils (1:7.7+6build2) ... Setting up tex-common (6.17) ... update-language: texlive-base not installed and configured, doing nothing! Setting up libthai0:riscv64 (0.1.29-1build1) ... Setting up libptexenc1:riscv64 (2021.20210626.59705-1build1) ... Setting up autoconf (2.71-2) ... Setting up dh-strip-nondeterminism (1.13.0-1) ... Setting up dwz (0.14-1build2) ... Setting up groff-base (1.22.4-8build1) ... Setting up lmodern (2.004.5-6.1) ... Setting up xml-core (0.18+nmu1) ... Setting up debugedit (1:5.0-4build1) ... Setting up libx11-6:riscv64 (2:1.7.5-1) ... Setting up libtiff5:riscv64 (4.3.0-6) ... Setting up libfontconfig1:riscv64 (2.13.1-4.2ubuntu5) ... Setting up libsm6:riscv64 (2:1.2.3-1build2) ... Setting up libxml2:riscv64 (2.9.13+dfsg-1build1) ... Setting up libavahi-client3:riscv64 (0.8-5ubuntu5) ... Setting up libmount-dev:riscv64 (2.37.2-4ubuntu3) ... Setting up automake (1:1.16.5-1.3) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up gettext (0.21-4ubuntu4) ... Setting up libxpm4:riscv64 (1:3.5.12-1build2) ... Setting up libxrender1:riscv64 (1:0.9.10-1build4) ... Setting up libsombok3:riscv64 (2.4.0-2) ... Setting up libxext6:riscv64 (2:1.3.4-1build1) ... Setting up man-db (2.10.2-1) ... Not building database; man-db/auto-update is not 'true'. Created symlink /etc/systemd/system/timers.target.wants/man-db.timer → /lib/systemd/system/man-db.timer. Setting up libcairo2:riscv64 (1.16.0-5ubuntu2) ... Setting up intltool-debian (0.35.0+20060710.5) ... Setting up dh-autoreconf (20) ... Setting up libglib2.0-dev:riscv64 (2.72.1-1) ... Setting up libunicode-linebreak-perl (0.0.20190101-1build3) ... Setting up netpbm (2:10.0-15.4) ... Setting up libxt6:riscv64 (1:1.2.1-1) ... Setting up libcups2:riscv64 (2.4.1op1-1ubuntu4) ... Setting up libxmu6:riscv64 (2:1.1.3-3) ... Setting up libgs9:riscv64 (9.55.0~dfsg1-0ubuntu5) ... Setting up libxi6:riscv64 (2:1.8-1build1) ... Setting up po-debconf (1.0.21+nmu1) ... Setting up debhelper (13.6ubuntu1) ... Setting up libxaw7:riscv64 (2:1.0.14-1) ... Setting up ghostscript (9.55.0~dfsg1-0ubuntu5) ... Setting up texlive-binaries (2021.20210626.59705-1build1) ... update-alternatives: using /usr/bin/xdvi-xaw to provide /usr/bin/xdvi.bin (xdvi.bin) in auto mode update-alternatives: using /usr/bin/bibtex.original to provide /usr/bin/bibtex (bibtex) in auto mode Setting up texlive-base (2021.20220204-1) ... /usr/bin/ucfr /usr/bin/ucfr /usr/bin/ucfr /usr/bin/ucfr tl-paper: setting paper size for dvips to a4: /var/lib/texmf/dvips/config/config-paper.ps tl-paper: setting paper size for dvipdfmx to a4: /var/lib/texmf/dvipdfmx/dvipdfmx-paper.cfg tl-paper: setting paper size for xdvi to a4: /var/lib/texmf/xdvi/XDvi-paper tl-paper: setting paper size for pdftex to a4: /var/lib/texmf/tex/generic/tex-ini-files/pdftexconfig.tex Setting up texlive-luatex (2021.20220204-1) ... Setting up texlive-plain-generic (2021.20220204-1) ... Setting up texlive-latex-base (2021.20220204-1) ... Setting up texlive-extra-utils (2021.20220204-1) ... Setting up hevea (2.35-1build1) ... Processing triggers for libc-bin (2.35-0ubuntu3) ... Processing triggers for sgml-base (1.30) ... Setting up sgml-data (2.0.11+nmu1) ... Processing triggers for sgml-base (1.30) ... Setting up docbook (4.5-9) ... Processing triggers for sgml-base (1.30) ... Setting up docbook-to-man (1:2.0.0-45) ... Setting up sbuild-build-depends-main-dummy (0.invalid.0) ... Processing triggers for tex-common (6.17) ... Running updmap-sys. This may take some time... done. Running mktexlsr /var/lib/texmf ... done. Building format(s) --all. This may take some time... done. +------------------------------------------------------------------------------+ | Check architectures | +------------------------------------------------------------------------------+ Arch check ok (riscv64 included in any all) +------------------------------------------------------------------------------+ | Build environment | +------------------------------------------------------------------------------+ Kernel: Linux 5.13.0-1019-generic #21~20.04.1-Ubuntu SMP Thu Mar 24 22:36:01 UTC 2022 riscv64 (riscv64) Toolchain package versions: binutils_2.38-3ubuntu1 dpkg-dev_1.21.1ubuntu11 g++-11_11.2.0-19ubuntu1 g++-12_12-20220319-1ubuntu1 gcc-11_11.2.0-19ubuntu1 gcc-12_12-20220319-1ubuntu1 libc6-dev_2.35-0ubuntu3 libstdc++-11-dev_11.2.0-19ubuntu1 libstdc++-12-dev_12-20220319-1ubuntu1 libstdc++6_12-20220319-1ubuntu1 linux-libc-dev_5.15.0-25.25 Package versions: adduser_3.118ubuntu5 advancecomp_2.1-2.1ubuntu2 apt_2.4.5 autoconf_2.71-2 automake_1:1.16.5-1.3 autopoint_0.21-4ubuntu4 autotools-dev_20220109.1 base-files_12ubuntu4 base-passwd_3.5.52build1 bash_5.1-6ubuntu1 binutils_2.38-3ubuntu1 binutils-common_2.38-3ubuntu1 binutils-riscv64-linux-gnu_2.38-3ubuntu1 bsdextrautils_2.37.2-4ubuntu3 bsdutils_1:2.37.2-4ubuntu3 build-essential_12.9ubuntu3 bzip2_1.0.8-5build1 ca-certificates_20211016 coreutils_8.32-4.1ubuntu1 cpp_4:12-20211211-1ubuntu2 cpp-11_11.2.0-19ubuntu1 cpp-12_12-20220319-1ubuntu1 dash_0.5.11+git20210903+057cd650a4ed-3build1 debconf_1.5.79ubuntu1 debhelper_13.6ubuntu1 debianutils_5.5-1ubuntu2 debugedit_1:5.0-4build1 dh-autoreconf_20 dh-strip-nondeterminism_1.13.0-1 diffutils_1:3.8-0ubuntu2 docbook_4.5-9 docbook-to-man_1:2.0.0-45 dpkg_1.21.1ubuntu11 dpkg-dev_1.21.1ubuntu11 dwz_0.14-1build2 e2fsprogs_1.46.5-2ubuntu1 fakeroot_1.28-1ubuntu1 file_1:5.41-3 findutils_4.8.0-1ubuntu3 fontconfig-config_2.13.1-4.2ubuntu5 fonts-dejavu-core_2.37-2build1 fonts-lmodern_2.004.5-6.1 fonts-urw-base35_20200910-1 g++_4:12-20211211-1ubuntu2 g++-11_11.2.0-19ubuntu1 g++-12_12-20220319-1ubuntu1 gcc_4:12-20211211-1ubuntu2 gcc-11_11.2.0-19ubuntu1 gcc-11-base_11.2.0-19ubuntu1 gcc-12_12-20220319-1ubuntu1 gcc-12-base_12-20220319-1ubuntu1 gettext_0.21-4ubuntu4 gettext-base_0.21-4ubuntu4 ghostscript_9.55.0~dfsg1-0ubuntu5 gpg_2.2.27-3ubuntu2 gpg-agent_2.2.27-3ubuntu2 gpgconf_2.2.27-3ubuntu2 gpgv_2.2.27-3ubuntu2 grep_3.7-1build1 groff-base_1.22.4-8build1 gzip_1.10-4ubuntu4 hevea_2.35-1build1 hostname_3.23ubuntu2 init_1.62 init-system-helpers_1.62 intltool-debian_0.35.0+20060710.5 libacl1_2.3.1-1 libapparmor1_3.0.4-2ubuntu2 libapt-pkg6.0_2.4.5 libarchive-zip-perl_1.68-1 libargon2-1_0~20171227-0.3 libasan6_11.2.0-19ubuntu1 libasan8_12-20220319-1ubuntu1 libassuan0_2.5.5-1build1 libatomic1_12-20220319-1ubuntu1 libattr1_1:2.5.1-1build1 libaudit-common_1:3.0.7-1build1 libaudit1_1:3.0.7-1build1 libavahi-client3_0.8-5ubuntu5 libavahi-common-data_0.8-5ubuntu5 libavahi-common3_0.8-5ubuntu5 libbinutils_2.38-3ubuntu1 libblkid-dev_2.37.2-4ubuntu3 libblkid1_2.37.2-4ubuntu3 libbrotli1_1.0.9-2build6 libbsd0_0.11.5-1 libbz2-1.0_1.0.8-5build1 libc-bin_2.35-0ubuntu3 libc-dev-bin_2.35-0ubuntu3 libc6_2.35-0ubuntu3 libc6-dev_2.35-0ubuntu3 libcairo2_1.16.0-5ubuntu2 libcap-ng0_0.7.9-2.2build3 libcap2_1:2.44-1build3 libcc1-0_12-20220319-1ubuntu1 libcom-err2_1.46.5-2ubuntu1 libcrypt-dev_1:4.4.27-1 libcrypt1_1:4.4.27-1 libcryptsetup12_2:2.4.3-1ubuntu1 libctf-nobfd0_2.38-3ubuntu1 libctf0_2.38-3ubuntu1 libcups2_2.4.1op1-1ubuntu4 libdatrie1_0.2.13-2 libdb5.3_5.3.28+dfsg1-0.8ubuntu3 libdbus-1-3_1.12.20-2ubuntu4 libdebconfclient0_0.261ubuntu1 libdebhelper-perl_13.6ubuntu1 libdeflate0_1.10-2 libdevmapper1.02.1_2:1.02.175-2.1ubuntu4 libdpkg-perl_1.21.1ubuntu11 libdw1_0.186-1build1 libelf1_0.186-1build1 libexpat1_2.4.7-1 libext2fs2_1.46.5-2ubuntu1 libfakeroot_1.28-1ubuntu1 libffi-dev_3.4.2-4 libffi8_3.4.2-4 libfile-stripnondeterminism-perl_1.13.0-1 libfontconfig1_2.13.1-4.2ubuntu5 libfontenc1_1:1.1.4-1build3 libfreetype6_2.11.1+dfsg-1build1 libgcc-11-dev_11.2.0-19ubuntu1 libgcc-12-dev_12-20220319-1ubuntu1 libgcc-s1_12-20220319-1ubuntu1 libgcrypt20_1.9.4-3ubuntu3 libgdbm-compat4_1.23-1 libgdbm6_1.23-1 libglib2.0-0_2.72.1-1 libglib2.0-bin_2.72.1-1 libglib2.0-data_2.72.1-1 libglib2.0-dev_2.72.1-1 libglib2.0-dev-bin_2.72.1-1 libgmp10_2:6.2.1+dfsg-3ubuntu1 libgnutls30_3.7.3-4ubuntu1 libgomp1_12-20220319-1ubuntu1 libgpg-error0_1.43-3 libgraphite2-3_1.3.14-1build2 libgs9_9.55.0~dfsg1-0ubuntu5 libgs9-common_9.55.0~dfsg1-0ubuntu5 libgssapi-krb5-2_1.19.2-2 libharfbuzz0b_2.7.4-1ubuntu3 libhogweed6_3.7.3-1build2 libice6_2:1.0.10-1build2 libicu70_70.1-2 libidn12_1.38-4build1 libidn2-0_2.3.2-2build1 libijs-0.35_0.35-15build2 libip4tc2_1.8.7-1ubuntu5 libisl23_0.24-2build1 libjbig0_2.1-3.1build3 libjbig2dec0_0.19-3build2 libjpeg-turbo8_2.1.2-0ubuntu1 libjpeg8_8c-2ubuntu10 libjs-jquery_3.6.0+dfsg+~3.5.13-1 libjson-c5_0.15-2build4 libk5crypto3_1.19.2-2 libkeyutils1_1.6.1-2ubuntu3 libkmod2_29-1ubuntu1 libkpathsea6_2021.20210626.59705-1build1 libkrb5-3_1.19.2-2 libkrb5support0_1.19.2-2 liblockfile-bin_1.17-1build2 liblockfile1_1.17-1build2 liblz4-1_1.9.3-2build2 liblzma5_5.2.5-2ubuntu1 libmagic-mgc_1:5.41-3 libmagic1_1:5.41-3 libmd0_1.0.4-1build1 libmime-charset-perl_1.012.2-1 libmount-dev_2.37.2-4ubuntu3 libmount1_2.37.2-4ubuntu3 libmpc3_1.2.1-2build1 libmpdec3_2.5.1-2build2 libmpfr6_4.1.0-3build3 libncurses6_6.3-2 libncursesw6_6.3-2 libnetpbm10_2:10.0-15.4 libnettle8_3.7.3-1build2 libnpth0_1.6-3build2 libnsl-dev_1.3.0-2build2 libnsl2_1.3.0-2build2 libopenjp2-7_2.4.0-6 libosp5_1.5.2-13ubuntu3 libp11-kit0_0.24.0-6build1 libpam-modules_1.4.0-11ubuntu2 libpam-modules-bin_1.4.0-11ubuntu2 libpam-runtime_1.4.0-11ubuntu2 libpam0g_1.4.0-11ubuntu2 libpaper-utils_1.1.28build2 libpaper1_1.1.28build2 libpcre16-3_2:8.39-13build5 libpcre2-16-0_10.39-3build1 libpcre2-32-0_10.39-3build1 libpcre2-8-0_10.39-3build1 libpcre2-dev_10.39-3build1 libpcre2-posix3_10.39-3build1 libpcre3_2:8.39-13build5 libpcre3-dev_2:8.39-13build5 libpcre32-3_2:8.39-13build5 libpcrecpp0v5_2:8.39-13build5 libperl5.32_5.32.1-3ubuntu3 libperl5.34_5.34.0-3ubuntu1 libpipeline1_1.5.5-1 libpixman-1-0_0.40.0-1build4 libpng16-16_1.6.37-3build5 libprocps8_2:3.3.17-6ubuntu2 libptexenc1_2021.20210626.59705-1build1 libpython3-stdlib_3.10.4-0ubuntu2 libpython3.10-minimal_3.10.4-3 libpython3.10-stdlib_3.10.4-3 libreadline8_8.1.2-1 libseccomp2_2.5.3-2ubuntu2 libselinux1_3.3-1build2 libselinux1-dev_3.3-1build2 libsemanage-common_3.3-1build2 libsemanage2_3.3-1build2 libsepol-dev_3.3-1build1 libsepol1_3.1-1ubuntu2 libsepol2_3.3-1build1 libsigsegv2_2.13-1ubuntu3 libsm6_2:1.2.3-1build2 libsmartcols1_2.37.2-4ubuntu3 libsombok3_2.4.0-2 libsqlite3-0_3.37.2-2 libss2_1.46.5-2ubuntu1 libssl1.1_1.1.1l-1ubuntu1 libssl3_3.0.2-0ubuntu1 libstdc++-11-dev_11.2.0-19ubuntu1 libstdc++-12-dev_12-20220319-1ubuntu1 libstdc++6_12-20220319-1ubuntu1 libsub-override-perl_0.09-2 libsynctex2_2021.20210626.59705-1build1 libsystemd0_249.11-0ubuntu3 libtasn1-6_4.18.0-4build1 libteckit0_2.5.11+ds1-1 libtexlua53_2021.20210626.59705-1build1 libthai-data_0.1.29-1build1 libthai0_0.1.29-1build1 libtiff5_4.3.0-6 libtinfo6_6.3-2 libtirpc-common_1.3.2-2build1 libtirpc-dev_1.3.2-2build1 libtirpc3_1.3.2-2build1 libtool_2.4.6-15build2 libuchardet0_0.0.7-1build2 libudev1_249.11-0ubuntu3 libunicode-linebreak-perl_0.0.20190101-1build3 libunistring2_1.0-1 libuuid1_2.37.2-4ubuntu3 libwebp7_1.2.2-2 libx11-6_2:1.7.5-1 libx11-data_2:1.7.5-1 libxau6_1:1.0.9-1build5 libxaw7_2:1.0.14-1 libxcb-render0_1.14-3ubuntu3 libxcb-shm0_1.14-3ubuntu3 libxcb1_1.14-3ubuntu3 libxdmcp6_1:1.1.3-0ubuntu5 libxext6_2:1.3.4-1build1 libxi6_2:1.8-1build1 libxml2_2.9.13+dfsg-1build1 libxmu6_2:1.1.3-3 libxpm4_1:3.5.12-1build2 libxrender1_1:0.9.10-1build4 libxt6_1:1.2.1-1 libxxhash0_0.8.1-1 libzstd1_1.4.8+dfsg-3build1 libzzip-0-13_0.13.72+dfsg.1-1.1 linux-libc-dev_5.15.0-25.25 lmodern_2.004.5-6.1 lockfile-progs_0.1.19build1 login_1:4.8.1-2ubuntu2 logsave_1.46.5-2ubuntu1 lsb-base_11.1.0ubuntu4 lto-disabled-list_24 m4_1.4.18-5ubuntu2 make_4.3-4.1build1 man-db_2.10.2-1 mawk_1.3.4.20200120-3 media-types_7.0.0 mount_2.37.2-4ubuntu3 ncurses-base_6.3-2 ncurses-bin_6.3-2 netpbm_2:10.0-15.4 opensp_1.5.2-13ubuntu3 openssl_3.0.2-0ubuntu1 optipng_0.7.7-2build1 passwd_1:4.8.1-2ubuntu2 patch_2.7.6-7build2 perl_5.34.0-3ubuntu1 perl-base_5.34.0-3ubuntu1 perl-modules-5.32_5.32.1-3ubuntu3 perl-modules-5.34_5.34.0-3ubuntu1 pinentry-curses_1.1.1-1build2 pkg-config_0.29.2-1ubuntu3 pkgbinarymangler_149 po-debconf_1.0.21+nmu1 policyrcd-script-zg2_0.1-3 poppler-data_0.4.11-1 procps_2:3.3.17-6ubuntu2 python3_3.10.4-0ubuntu2 python3-distutils_3.10.4-0ubuntu1 python3-lib2to3_3.10.4-0ubuntu1 python3-minimal_3.10.4-0ubuntu2 python3-psutil_5.9.0-1build1 python3.10_3.10.4-3 python3.10-minimal_3.10.4-3 readline-common_8.1.2-1 rpcsvc-proto_1.4.2-0ubuntu6 sbuild-build-depends-main-dummy_0.invalid.0 sed_4.8-1ubuntu2 sensible-utils_0.0.17 sgml-base_1.30 sgml-data_2.0.11+nmu1 systemd_249.11-0ubuntu3 systemd-sysv_249.11-0ubuntu3 systemd-timesyncd_249.11-0ubuntu3 sysvinit-utils_3.01-1ubuntu1 t1utils_1.41-4build2 tar_1.34+dfsg-1build3 tex-common_6.17 texlive-base_2021.20220204-1 texlive-binaries_2021.20210626.59705-1build1 texlive-extra-utils_2021.20220204-1 texlive-latex-base_2021.20220204-1 texlive-luatex_2021.20220204-1 texlive-plain-generic_2021.20220204-1 tzdata_2022a-0ubuntu1 ubuntu-keyring_2021.03.26 ucf_3.0043 usrmerge_25ubuntu2 util-linux_2.37.2-4ubuntu3 uuid-dev_2.37.2-4ubuntu3 x11-common_1:7.7+23ubuntu2 xdg-utils_1.1.3-4.1ubuntu1 xfonts-encodings_1:1.0.5-0ubuntu2 xfonts-utils_1:7.7+6build2 xml-core_0.18+nmu1 xz-utils_5.2.5-2ubuntu1 zlib1g_1:1.2.11.dfsg-2ubuntu9 zlib1g-dev_1:1.2.11.dfsg-2ubuntu9 +------------------------------------------------------------------------------+ | Build | +------------------------------------------------------------------------------+ Unpack source ------------- -----BEGIN PGP SIGNED MESSAGE----- Hash: SHA512 Format: 3.0 (quilt) Source: wise Binary: wise, wise-doc, wise-data Architecture: any all Version: 2.4.1-23 Maintainer: Debian Med Packaging Team Uploaders: Steffen Moeller , Charles Plessy , Andreas Tille Homepage: https://www.ebi.ac.uk/~birney/wise2/ Standards-Version: 4.5.0 Vcs-Browser: https://salsa.debian.org/med-team/wise Vcs-Git: https://salsa.debian.org/med-team/wise.git Testsuite: autopkgtest Build-Depends: debhelper-compat (= 12), texlive-latex-base, texlive-extra-utils, hevea, docbook-to-man, libglib2.0-dev Package-List: wise deb science optional arch=any wise-data deb doc optional arch=all wise-doc deb doc optional arch=all Checksums-Sha1: 50215e0541ed043d2ee44463da1b1a0d5272d724 3410178 wise_2.4.1.orig.tar.gz 3a0b88d342fb1b6ac2ee20ced2dcbcdf44795439 27152 wise_2.4.1-23.debian.tar.xz Checksums-Sha256: 0aec5e30739110783517a429606249fc6c5fd0d65171c1a6d79ecc5ff81d2935 3410178 wise_2.4.1.orig.tar.gz 432297bafe4688cd3f3041e5d8897792ef1b7cd3afb7bef3d06274abf28d7772 27152 wise_2.4.1-23.debian.tar.xz Files: 9e90132c19a653831ce63b5af7f08302 3410178 wise_2.4.1.orig.tar.gz 55b2719ab85acb83f518de3c19708e95 27152 wise_2.4.1-23.debian.tar.xz -----BEGIN PGP SIGNATURE----- iQJFBAEBCgAvFiEE8fAHMgoDVUHwpmPKV4oElNHGRtEFAl6bJzMRHHRpbGxlQGRl Ymlhbi5vcmcACgkQV4oElNHGRtHl8Q//SYLAoXInTt3fiR2c5KDeaDzjnrsuW6MZ sUvYH9VA9f0kUA5avHcQ2GU82pZoDKRxWRW4xmLhOqUDMCfCkAnah44RDWPQeBLE lPGK1U8zn0P+XI1dWZuEtjfRuYKJwjzcAGOd0AqONrzFfzxfpc9ug1RvC0ERl/5R wBGZ6dUcjJ3uDK4klKPCVtSg6WBq+/fcCTYJiepxW0I7y1mbT70nJXuNnWtevqcV ifhlJuihR8N20fOobQM8uVhcDAFc8xqsgsc1022qhW3Lh1YR4r3hy3O849K7JG5b xt9Fj6AtHhLWwsoV2g6/k8kTrlhT4e48BwFnHaV3POGRyNfMjil5MAdomF7uOP9Q HJ8w+tmliP+ItPD24FXESngPQQtz6wMjtMC1rIFWEkznIxJW8gGfEwm78hWsP8Tz nsJT6F1s6AhXgSq5O713EY3jYDOazav59KwFPzlllOhKyO5u+Fd+M0D1SZa+XfnG GHc3fCdVoeUItIbM0nAXqMWJe4XoZiL8aTSu31Qez2UvvnFPIlv0dAXpw6+KvBzA iYR3fsQB/Ger5nXUGXed8U6G9dYKMdAToP6iBLp3L4zpc6CPNKahReiYg5VKzoC+ +NlYUFB7wjKcFBnW/Kkc7d53aHdFPHJASZfAGEIO7RjgaUqafOYhL8N4QnJSw5KI REUWZmItrSU= =K6w+ -----END PGP SIGNATURE----- gpgv: Signature made Sat Apr 18 16:13:39 2020 UTC gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1 gpgv: issuer "tille@debian.org" gpgv: Can't check signature: No public key dpkg-source: warning: cannot verify signature ./wise_2.4.1-23.dsc dpkg-source: info: extracting wise in /<> dpkg-source: info: unpacking wise_2.4.1.orig.tar.gz dpkg-source: info: unpacking wise_2.4.1-23.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying 01_welcome-csh.patch dpkg-source: info: applying 02_isnumber.patch dpkg-source: info: applying 03_doc-nodycache.patch dpkg-source: info: applying 04_wise2-pdflatex-update.patch dpkg-source: info: applying 05_glib2.patch dpkg-source: info: applying 06_getline.patch dpkg-source: info: applying 07_ld--as-needed.patch dpkg-source: info: applying 08_mayhem.patch dpkg-source: info: applying 09_dnal-add-return-statement.patch dpkg-source: info: applying 10_fix_path_to_data_files.patch dpkg-source: info: applying 11_consistent_manual_dates.patch dpkg-source: info: applying spelling.patch dpkg-source: info: applying cross.patch Check disk space ---------------- Sufficient free space for build User Environment ---------------- APT_CONFIG=/var/lib/sbuild/apt.conf DEB_BUILD_OPTIONS=noautodbgsym parallel=8 HOME=/sbuild-nonexistent LANG=C.UTF-8 LC_ALL=C.UTF-8 LOGNAME=buildd PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games SCHROOT_ALIAS_NAME=build-PACKAGEBUILD-23475775 SCHROOT_CHROOT_NAME=build-PACKAGEBUILD-23475775 SCHROOT_COMMAND=env SCHROOT_GID=2501 SCHROOT_GROUP=buildd SCHROOT_SESSION_ID=build-PACKAGEBUILD-23475775 SCHROOT_UID=2001 SCHROOT_USER=buildd SHELL=/bin/sh TERM=unknown USER=buildd V=1 dpkg-buildpackage ----------------- Command: dpkg-buildpackage -us -uc -mLaunchpad Build Daemon -B -rfakeroot dpkg-buildpackage.pl: info: source package wise dpkg-buildpackage.pl: info: source version 2.4.1-23 dpkg-buildpackage.pl: info: source distribution unstable dpkg-source --before-build . dpkg-buildpackage.pl: info: host architecture riscv64 debian/rules clean dh clean debian/rules override_dh_clean make[1]: Entering directory '/<>' /usr/bin/make -C src clean make[2]: Entering directory '/<>/src' cd external ; /usr/bin/make clean make[3]: Entering directory '/<>/src/external' (cd mott; make clean) make[4]: Entering directory '/<>/src/external/mott' rm -f *.[oa] make[4]: Leaving directory '/<>/src/external/mott' make[3]: Leaving directory '/<>/src/external' if test -d dynlibsrc; then cd dynlibsrc ; rm -f *.[oa]; fi if test -d models; then cd models ; rm -f *.[oa]; fi if test -d base; then cd base ; rm -f *.[oa]; fi if test -d socket; then cd socket ; rm -f *.[oa]; fi if test -d dnaindex; then cd dnaindex ; rm -f *.[oa]; fi if test -d network; then cd network ; rm -f *.[oa]; fi if test -d dyc; then cd dyc ; rm -f *.[oa]; fi if test -d HMMer2; then cd HMMer2 ; rm -f *.[oa]; fi if test -d perl; then cd perl/Wise2/libs ; rm -f *.[oa]; fi if test -x perl/Wise2/Makefile; then cd perl/Wise2/ ; /usr/bin/make clean; fi if test -d oldbin; then rm -rf oldbin; fi if test -d bin; then echo 'moving binaries to oldbin'; mv -f bin oldbin; fi make[2]: Leaving directory '/<>/src' /usr/bin/make -C debian/manpages.d clean make[2]: Entering directory '/<>/debian/manpages.d' rm -f dba.1 dnal.1 estwise.1 estwisedb.1 genewise.1 genewisedb.1 genomewise.1 promoterwise.1 psw.1 pswdb.1 scanwise.1 scanwise_server.1 make[2]: Leaving directory '/<>/debian/manpages.d' rm -f -r src/oldbin for i in dba psw dnal genomewise pswdb scanwise estwise genewise sywise genewisedb promoterwise pseudowise estwisedb; do rm -f src/models/$i; done rm -f src/network/scanwise_server rm -f docs/temp.tex rm -f docs/api.* rm -f docs/wise2.image.tex rm -f docs/*.pdf rm -f docs/*.aux rm -f docs/*.log rm -f docs/*.toc rm -f docs/*.pdf rm -f docs/*.dvi rm -f docs/*.ps rm -f docs/*.4ct rm -f docs/*.4tc rm -f docs/*.css rm -f docs/*.idv rm -f docs/*.lg rm -f docs/*.tmp rm -f docs/*.xref rm -f docs/*.haux rm -f docs/*.htoc rm -f docs/*.html rm -f -r docs/api rm -f -r docs/dynamite rm -f -r docs/wise2 dh_clean rm -f debian/debhelper-build-stamp rm -rf debian/.debhelper/ rm -f -- debian/wise.substvars debian/wise-doc.substvars debian/wise-data.substvars debian/files rm -fr -- debian/wise/ debian/tmp/ debian/wise-doc/ debian/wise-data/ find . \( \( \ \( -path .\*/.git -o -path .\*/.svn -o -path .\*/.bzr -o -path .\*/.hg -o -path .\*/CVS -o -path .\*/.pc -o -path .\*/_darcs \) -prune -o -type f -a \ \( -name '#*#' -o -name '.*~' -o -name '*~' -o -name DEADJOE \ -o -name '*.orig' -o -name '*.rej' -o -name '*.bak' \ -o -name '.*.orig' -o -name .*.rej -o -name '.SUMS' \ -o -name TAGS -o \( -path '*/.deps/*' -a -name '*.P' \) \ \) -exec rm -f {} + \) -o \ \( -type d -a -name autom4te.cache -prune -exec rm -rf {} + \) \) make[1]: Leaving directory '/<>' debian/rules binary-arch dh binary-arch dh_update_autotools_config -a dh_autoreconf -a debian/rules override_dh_auto_build make[1]: Entering directory '/<>' dh_auto_build --sourcedirectory=src -- all cd src && make -j8 "INSTALL=install --strip-program=true" all make[2]: Entering directory '/<>/src' (cd base ; make CC="cc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" libwisebase.a ) make[3]: Entering directory '/<>/src/base' cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include wiseconfig.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include wisestring.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include wiseerror.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include wisememman.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include wisefile.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include wiserandom.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include wisetime.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include wiseoverlay.c wisefile.dy: In function ‘Wise2_myfclose’: wisefile.dy:72:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘FILE *’ [-Wformat=] 72 | fprintf(stderr,"Closing %d\n",ofp); | ^~~~~~~~~~~~~~ ~~~ | | | FILE * cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include wisestreaminterface.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include commandline.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include linesubs.c ar ru libwisebase.a wiseconfig.o wisestring.o wiseerror.o wisememman.o wisefile.o wiserandom.o wisetime.o wiseoverlay.o wisestreaminterface.o commandline.o linesubs.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libwisebase.a if test -x /bin/ranlib; then /bin/ranlib libwisebase.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libwisebase.a; else exit 0; fi make[3]: Leaving directory '/<>/src/base' (cd HMMer2 ; make CC="cc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" libhmmer.a ) make[3]: Entering directory '/<>/src/HMMer2' cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c alphabet.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c core_algorithms.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c debug.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c emit.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c emulation.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c histogram.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c hmmio.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c mathsupport.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c masks.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c misc.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c modelmakers.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c plan7.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c plan9.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c prior.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c tophits.c prior.c: In function ‘P7ReadPrior’: prior.c:102:12: warning: implicit declaration of function ‘strcmp’ [-Wimplicit-function-declaration] 102 | if (strcmp(sptr, "DIRICHLET") == 0) pri->strategy = PRI_DCHLET; | ^~~~~~ prior.c:10:1: note: include ‘’ or provide a declaration of ‘strcmp’ 9 | #include "funcs.h" +++ |+#include 10 | #include "squid.h" cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c trace.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c aligneval.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c alignio.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c cluster.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c dayhoff.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c file.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c getopt.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c gnuregex.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c interleaved.c gnuregex.c: In function ‘re_match_2’: gnuregex.c:3752:31: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] 3752 | if ((int) old_regend[r] >= (int) regstart[r]) | ^ gnuregex.c:3752:54: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] 3752 | if ((int) old_regend[r] >= (int) regstart[r]) | ^ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 2315 | fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item | ^ gnuregex.c:2394:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ 2394 | PUSH_FAILURE_ITEM (lowest_active_reg); \ | ^~~~~~~~~~~~~~~~~ gnuregex.c:3758:19: note: in expansion of macro ‘PUSH_FAILURE_POINT’ 3758 | PUSH_FAILURE_POINT (p1 + mcnt, d, -2); | ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 2315 | fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item | ^ gnuregex.c:2397:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ 2397 | PUSH_FAILURE_ITEM (highest_active_reg); \ | ^~~~~~~~~~~~~~~~~ gnuregex.c:3758:19: note: in expansion of macro ‘PUSH_FAILURE_POINT’ 3758 | PUSH_FAILURE_POINT (p1 + mcnt, d, -2); | ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 2315 | fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item | ^ gnuregex.c:2394:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ 2394 | PUSH_FAILURE_ITEM (lowest_active_reg); \ | ^~~~~~~~~~~~~~~~~ gnuregex.c:3905:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ 3905 | PUSH_FAILURE_POINT (p + mcnt, NULL, -2); | ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 2315 | fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item | ^ gnuregex.c:2397:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ 2397 | PUSH_FAILURE_ITEM (highest_active_reg); \ | ^~~~~~~~~~~~~~~~~ gnuregex.c:3905:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ 3905 | PUSH_FAILURE_POINT (p + mcnt, NULL, -2); | ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 2315 | fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item | ^ gnuregex.c:2394:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ 2394 | PUSH_FAILURE_ITEM (lowest_active_reg); \ | ^~~~~~~~~~~~~~~~~ gnuregex.c:3958:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ 3958 | PUSH_FAILURE_POINT (p + mcnt, d, -2); | ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 2315 | fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item | ^ gnuregex.c:2397:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ 2397 | PUSH_FAILURE_ITEM (highest_active_reg); \ | ^~~~~~~~~~~~~~~~~ gnuregex.c:3958:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ 3958 | PUSH_FAILURE_POINT (p + mcnt, d, -2); | ^~~~~~~~~~~~~~~~~~ gnuregex.c:2482:14: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] 2482 | high_reg = (unsigned) POP_FAILURE_ITEM (); \ | ^ gnuregex.c:4064:13: note: in expansion of macro ‘POP_FAILURE_POINT’ 4064 | POP_FAILURE_POINT (sdummy, pdummy, | ^~~~~~~~~~~~~~~~~ gnuregex.c:2485:13: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] 2485 | low_reg = (unsigned) POP_FAILURE_ITEM (); \ | ^ gnuregex.c:4064:13: note: in expansion of macro ‘POP_FAILURE_POINT’ 4064 | POP_FAILURE_POINT (sdummy, pdummy, | ^~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 2315 | fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item | ^ gnuregex.c:2394:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ 2394 | PUSH_FAILURE_ITEM (lowest_active_reg); \ | ^~~~~~~~~~~~~~~~~ gnuregex.c:4097:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ 4097 | PUSH_FAILURE_POINT (0, 0, -2); | ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 2315 | fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item | ^ gnuregex.c:2397:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ 2397 | PUSH_FAILURE_ITEM (highest_active_reg); \ | ^~~~~~~~~~~~~~~~~ gnuregex.c:4097:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ 4097 | PUSH_FAILURE_POINT (0, 0, -2); | ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 2315 | fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item | ^ gnuregex.c:2394:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ 2394 | PUSH_FAILURE_ITEM (lowest_active_reg); \ | ^~~~~~~~~~~~~~~~~ gnuregex.c:4110:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ 4110 | PUSH_FAILURE_POINT (0, 0, -2); | ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 2315 | fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item | ^ gnuregex.c:2397:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ 2397 | PUSH_FAILURE_ITEM (highest_active_reg); \ | ^~~~~~~~~~~~~~~~~ gnuregex.c:4110:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ 4110 | PUSH_FAILURE_POINT (0, 0, -2); | ^~~~~~~~~~~~~~~~~~ gnuregex.c:2482:14: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] 2482 | high_reg = (unsigned) POP_FAILURE_ITEM (); \ | ^ gnuregex.c:4278:11: note: in expansion of macro ‘POP_FAILURE_POINT’ 4278 | POP_FAILURE_POINT (d, p, | ^~~~~~~~~~~~~~~~~ gnuregex.c:2485:13: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] 2485 | low_reg = (unsigned) POP_FAILURE_ITEM (); \ | ^ gnuregex.c:4278:11: note: in expansion of macro ‘POP_FAILURE_POINT’ 4278 | POP_FAILURE_POINT (d, p, | ^~~~~~~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c iupac.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c msf.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c revcomp.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c selex.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c sqerror.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c sqio.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c sre_ctype.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c sre_math.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c sre_string.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c stack.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c translate.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c types.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -c weight.c ar rcv libhmmer.a alphabet.o core_algorithms.o debug.o emit.o emulation.o histogram.o hmmio.o mathsupport.o masks.o misc.o modelmakers.o plan7.o plan9.o prior.o tophits.o trace.o aligneval.o alignio.o cluster.o dayhoff.o file.o getopt.o gnuregex.o interleaved.o iupac.o msf.o revcomp.o selex.o sqerror.o sqio.o sre_ctype.o sre_math.o sre_string.o stack.o translate.o types.o weight.o a - alphabet.o a - core_algorithms.o a - debug.o a - emit.o a - emulation.o a - histogram.o a - hmmio.o a - mathsupport.o a - masks.o a - misc.o a - modelmakers.o a - plan7.o a - plan9.o a - prior.o a - tophits.o a - trace.o a - aligneval.o a - alignio.o a - cluster.o a - dayhoff.o a - file.o a - getopt.o a - gnuregex.o a - interleaved.o a - iupac.o a - msf.o a - revcomp.o a - selex.o a - sqerror.o a - sqio.o a - sre_ctype.o a - sre_math.o a - sre_string.o a - stack.o a - translate.o a - types.o a - weight.o if test -x /bin/ranlib; then /bin/ranlib libhmmer.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libhmmer.a; else exit 0; fi if test -x ranlib; then ranlib libhmmer.a; else exit 0; fi chmod 644 libhmmer.a make[3]: Leaving directory '/<>/src/HMMer2' (cd dynlibsrc ; make CC="cc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" libdyna.a ) make[3]: Entering directory '/<>/src/dynlibsrc' cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ packaln.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ aln.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ dnamatrix.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ probability.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ alnrange.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ alnconvert.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ basematrix.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ shattermatrix.c aln.dy: In function ‘Wise2_mapped_ascii_AlnBlock’: aln.dy:867:19: warning: too many arguments for format [-Wformat-extra-args] 867 | fprintf(ofp," {%3.2f} ",(double)(*score_to_double)(cuml),cuml); | ^~~~~~~~~~~~ packaln.dy: In function ‘Wise2_read_simple_PackAln’: packaln.dy:88:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 88 | fgets(buffer,MAXLINE,ifp); | ^~~~~~~~~~~~~~~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ matrixdebug.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ dpenvelope.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ dbsearchimpl.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ dprunimpl.c matrixdebug.dy: In function ‘Wise2_user_DebugMatrix’: matrixdebug.dy:208:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 208 | fgets(buffer,MAXLINE,in); | ^~~~~~~~~~~~~~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ complexsequence.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ complexevalset.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ complexconsensi.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ sequence.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ sequencestream.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ seqalign.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ hitlist.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ hsp.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ hspstream.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ codon.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ compmat.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ codonmatrix.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ codonmapper.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ sequencedb.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ hscore.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ seqlookup.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ arrayseqlookup.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ genericindexresult.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ linkedlist_lookpos.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ singlenumberspace.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ histogram.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ searchstatinterface.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ searchstatlookup.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ proteindb.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ protein.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ pairbase.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ pairbaseseq.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ genomicdb.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ randommodel.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ randomdb.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ genomic.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ cdna.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ cdnadb.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ dna.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ embl.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ genomicregion.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ gene.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ transcript.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ translation.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ btcanvas.c genomicregion.dy: In function ‘Wise2_read_EMBL_FT_into_GenomicRegion’: genomicregion.dy:756:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 756 | fgets(buffer,maxlen,ifp); | ^~~~~~~~~~~~~~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ asciibtcanvas.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ dynlibcross.c ar ru libdyna.a packaln.o aln.o dnamatrix.o probability.o alnrange.o alnconvert.o basematrix.o shattermatrix.o matrixdebug.o dpenvelope.o dbsearchimpl.o dprunimpl.o complexsequence.o complexevalset.o complexconsensi.o sequence.o sequencestream.o seqalign.o hitlist.o hsp.o hspstream.o codon.o compmat.o codonmatrix.o codonmapper.o sequencedb.o hscore.o seqlookup.o arrayseqlookup.o genericindexresult.o linkedlist_lookpos.o singlenumberspace.o histogram.o searchstatinterface.o searchstatlookup.o proteindb.o protein.o pairbase.o pairbaseseq.o genomicdb.o randommodel.o randomdb.o genomic.o cdna.o cdnadb.o dna.o embl.o genomicregion.o gene.o transcript.o translation.o btcanvas.o asciibtcanvas.o dynlibcross.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libdyna.a if test -x /bin/ranlib; then /bin/ranlib libdyna.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libdyna.a; else exit 0; fi make[3]: Leaving directory '/<>/src/dynlibsrc' (cd dynlibsrc ; make CC="cc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" libdyna_glib.a ) make[3]: Entering directory '/<>/src/dynlibsrc' cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ subseqhash.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ intallocator.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ proteinstreamedindex.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ shadowseq.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ shadowseqindex.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ hsphandler.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ hspscaninterface.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ hsp2hitscan.c shadowseqindex.dy: In function ‘Wise2_dump_stats_ShadowSequenceIndex’: shadowseqindex.dy:285:15: warning: format ‘%f’ expects argument of type ‘double’, but argument 4 has type ‘long unsigned int’ [-Wformat=] 285 | fprintf(ofp,"Head memory %d [%.2f Mbytes]\n",total_head,(total_head*sizeof(ShadowArraySeqHead))/100000); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | long unsigned int subseqhash.dy: In function ‘Wise2_is_populated_subseqhash_ghash’: subseqhash.dy:111:29: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 111 | if( g_hash_table_lookup(h,(gconstpointer)seq_number) == NULL ) { | ^ subseqhash.dy: In function ‘Wise2_lookup_subseqhash_ghash’: subseqhash.dy:128:85: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 128 | return new_linkedl_SeqLookupResultInterface((SeqLookupPos *)g_hash_table_lookup(h,(gconstpointer)seq_number)); | ^ subseqhash.dy: In function ‘Wise2_add_seq_subseqhash_ghash’: subseqhash.dy:160:54: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 160 | if((ret = (SeqLookupPos *) g_hash_table_lookup(h,(gconstpointer)seq_number)) == NULL ) { | ^ subseqhash.dy:161:29: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 161 | g_hash_table_insert(h,(gpointer)seq_number,p); | ^ subseqhash.dy: In function ‘Wise2_add_direct_number_subseqhash_ghash’: subseqhash.dy:188:52: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 188 | if((ret = (SeqLookupPos *) g_hash_table_lookup(h,(gconstpointer)seq_number)) == NULL ) { | ^ subseqhash.dy:189:27: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] 189 | g_hash_table_insert(h,(gpointer)seq_number,p); | ^ hsp2hitscan.dy: In function ‘Wise2_one_off_two_hit_HSPscan_query_direct’: hsp2hitscan.dy:209:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 209 | fprintf(stderr,"START %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~ 210 | use.ru_utime.tv_sec, | ~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:209:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 209 | fprintf(stderr,"START %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~ 210 | use.ru_utime.tv_sec, 211 | use.ru_utime.tv_sec/1000, | ~~~~~~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:209:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 5 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 209 | fprintf(stderr,"START %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~ ...... 212 | use.ru_stime.tv_sec, | ~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:209:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 6 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 209 | fprintf(stderr,"START %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~ ...... 213 | use.ru_stime.tv_sec/1000 | ~~~~~~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:273:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 273 | fprintf(stderr,"END OF SEED %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 274 | use.ru_utime.tv_sec, | ~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:273:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 273 | fprintf(stderr,"END OF SEED %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 274 | use.ru_utime.tv_sec, 275 | use.ru_utime.tv_sec/1000, | ~~~~~~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:273:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 5 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 273 | fprintf(stderr,"END OF SEED %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ...... 276 | use.ru_stime.tv_sec, | ~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:273:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 6 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 273 | fprintf(stderr,"END OF SEED %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ...... 277 | use.ru_stime.tv_sec/1000 | ~~~~~~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:286:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 286 | fprintf(stderr,"POPULATION %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 287 | use.ru_utime.tv_sec, | ~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:286:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 286 | fprintf(stderr,"POPULATION %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 287 | use.ru_utime.tv_sec, 288 | use.ru_utime.tv_sec/1000, | ~~~~~~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:286:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 5 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 286 | fprintf(stderr,"POPULATION %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ...... 289 | use.ru_stime.tv_sec, | ~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:286:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 6 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 286 | fprintf(stderr,"POPULATION %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ...... 290 | use.ru_stime.tv_sec/1000 | ~~~~~~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:302:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 302 | fprintf(stdout,"LINEARISED %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 303 | use.ru_utime.tv_sec, | ~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:302:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 302 | fprintf(stdout,"LINEARISED %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 303 | use.ru_utime.tv_sec, 304 | use.ru_utime.tv_sec/1000, | ~~~~~~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:302:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 5 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 302 | fprintf(stdout,"LINEARISED %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ...... 305 | use.ru_stime.tv_sec, | ~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} hsp2hitscan.dy:302:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 6 has type ‘__time_t’ {aka ‘long int’} [-Wformat=] 302 | fprintf(stdout,"LINEARISED %d.%03du %d.%03ds \n", | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ...... 306 | use.ru_stime.tv_sec/1000 | ~~~~~~~~~~~~~~~~~~~~~~~~ | | | __time_t {aka long int} cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ hsplookupscan.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ hsplookupthreaded.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ hspthreadeddb.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ hspscanruntime.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ hsptwohitscan.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ proteinindexcons.c hspthreadeddb.dy: In function ‘Wise2_threadeddb_scan_worker’: hspthreadeddb.dy:154:77: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] 154 | fprintf(stderr,"For segment %d, finished query with %d (%d) linear\n",seg,(int)seg->lm,seg->lm->len); | ^ hspthreadeddb.dy:154:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘Wise2_HSPDatabaseSegment *’ [-Wformat=] 154 | fprintf(stderr,"For segment %d, finished query with %d (%d) linear\n",seg,(int)seg->lm,seg->lm->len); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ | | | Wise2_HSPDatabaseSegment * hsplookupthreaded.dy: In function ‘Wise2_one_off_ordered_HSPscan_scan_query_direct’: hsplookupthreaded.dy:263:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘long int’ [-Wformat=] 263 | fprintf(stderr,"retrieved array with %d elements\n",current_oph); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ | | | long int cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ dnaindexcons.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ staticseq.c ar ru libdyna_glib.a subseqhash.o intallocator.o proteinstreamedindex.o shadowseq.o shadowseqindex.o hsphandler.o hspscaninterface.o hsp2hitscan.o hsplookupscan.o hsplookupthreaded.o hspthreadeddb.o hspscanruntime.o hsptwohitscan.o proteinindexcons.o dnaindexcons.o staticseq.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libdyna_glib.a if test -x /bin/ranlib; then /bin/ranlib libdyna_glib.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libdyna_glib.a; else exit 0; fi make[3]: Leaving directory '/<>/src/dynlibsrc' (cd external ; make CC="cc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" all ) make[3]: Entering directory '/<>/src/external' (cd mott; make CC="cc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include" all) make[4]: Entering directory '/<>/src/external/mott' make[4]: warning: jobserver unavailable: using -j1. Add '+' to parent make rule. cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -Wdate-time -D_FORTIFY_SOURCE=2 -c -o mott_api.o mott_api.c mott_api.c: In function ‘InitPvaluesMott’: mott_api.c:64:3: warning: implicit declaration of function ‘free’ [-Wimplicit-function-declaration] 64 | free(freq0); | ^~~~ mott_api.c:5:1: note: include ‘’ or provide a declaration of ‘free’ 4 | #include"gapstat.h" +++ |+#include 5 | mott_api.c:64:3: warning: incompatible implicit declaration of built-in function ‘free’ [-Wbuiltin-declaration-mismatch] 64 | free(freq0); | ^~~~ mott_api.c:64:3: note: include ‘’ or provide a declaration of ‘free’ mott_api.c: In function ‘SW_PValueMott’: mott_api.c:104:7: warning: incompatible implicit declaration of built-in function ‘free’ [-Wbuiltin-declaration-mismatch] 104 | free(freqA); | ^~~~ mott_api.c:104:7: note: include ‘’ or provide a declaration of ‘free’ mott_api.c: In function ‘KarlinAltschulStatistics2’: mott_api.c:144:5: warning: incompatible implicit declaration of built-in function ‘free’ [-Wbuiltin-declaration-mismatch] 144 | free(h+hmin); | ^~~~ mott_api.c:144:5: note: include ‘’ or provide a declaration of ‘free’ mott_api.c:155:5: warning: incompatible implicit declaration of built-in function ‘free’ [-Wbuiltin-declaration-mismatch] 155 | free(h+hmin); | ^~~~ mott_api.c:155:5: note: include ‘’ or provide a declaration of ‘free’ mott_api.c: In function ‘GetHistogram’: mott_api.c:179:16: warning: implicit declaration of function ‘calloc’ [-Wimplicit-function-declaration] 179 | h = (double*)calloc(*hmax-*hmin+1,sizeof(double))-*hmin; | ^~~~~~ mott_api.c:179:16: note: include ‘’ or provide a declaration of ‘calloc’ mott_api.c:179:16: warning: incompatible implicit declaration of built-in function ‘calloc’ [-Wbuiltin-declaration-mismatch] mott_api.c:179:16: note: include ‘’ or provide a declaration of ‘calloc’ mott_api.c: In function ‘PseudoResidueFrequencies2’: mott_api.c:207:12: warning: implicit declaration of function ‘toupper’ [-Wimplicit-function-declaration] 207 | freq[toupper(seq[n])]++; | ^~~~~~~ mott_api.c:5:1: note: include ‘’ or provide a declaration of ‘toupper’ 4 | #include"gapstat.h" +++ |+#include 5 | mott_api.c: In function ‘RobinsonResidueFrequencies2’: mott_api.c:230:27: warning: incompatible implicit declaration of built-in function ‘calloc’ [-Wbuiltin-declaration-mismatch] 230 | double *freq = (double*)calloc(256, sizeof(double)); | ^~~~~~ mott_api.c:230:27: note: include ‘’ or provide a declaration of ‘calloc’ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -Wdate-time -D_FORTIFY_SOURCE=2 -c -o gaplib.o gaplib.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../../dynlibsrc -I../../base wise2_mott_bridge.c ar ru libmott.a mott_api.o gaplib.o wise2_mott_bridge.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libmott.a if test -x /bin/ranlib; then /bin/ranlib libmott.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libmott.a; else exit 0; fi make[4]: Leaving directory '/<>/src/external/mott' make[3]: Leaving directory '/<>/src/external' (cd socket ; make CC="cc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" libwisesocket.a ) make[3]: Entering directory '/<>/src/socket' cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ functionserver.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ functionclient.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ anonobj.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ transferinterface.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ directsocketwrite.c functionserver.dy: In function ‘Wise2_main_loop_forking_FunctionServer’: functionserver.dy:129:11: warning: ignoring return value of ‘write’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 129 | write(new_socket,buf,9); | ^~~~~~~~~~~~~~~~~~~~~~~ functionserver.dy:141:9: warning: ignoring return value of ‘write’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 141 | write(new_socket,buf,6); | ^~~~~~~~~~~~~~~~~~~~~~~ functionserver.dy:183:9: warning: ignoring return value of ‘write’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 183 | write(new_socket,buf,5); | ^~~~~~~~~~~~~~~~~~~~~~~ functionclient.dy: In function ‘Wise2_new_FunctionProxyCoordinator’: functionclient.dy:193:24: warning: passing argument 2 of ‘connect’ from incompatible pointer type [-Wincompatible-pointer-types] 193 | connect(out->socket, &server, sizeof(server)); | ^~~~~~~ | | | struct sockaddr_in * In file included from functionclient.c:7: /usr/include/riscv64-linux-gnu/sys/socket.h:126:52: note: expected ‘const struct sockaddr *’ but argument is of type ‘struct sockaddr_in *’ 126 | extern int connect (int __fd, __CONST_SOCKADDR_ARG __addr, socklen_t __len); | ^ ar ru libwisesocket.a functionserver.o functionclient.o anonobj.o transferinterface.o directsocketwrite.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libwisesocket.a if test -x /bin/ranlib; then /bin/ranlib libwisesocket.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libwisesocket.a; else exit 0; fi make[3]: Leaving directory '/<>/src/socket' (cd dnaindex ; make CC="cc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" all ) make[3]: Entering directory '/<>/src/dnaindex' cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_assembly.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_index_interface.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_direct.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_hash.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_count.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_glib_index.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models singleseqspace.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models dnamapping.c kmer_assembly.dy: In function ‘Wise2_show_KmerAssemblyNode’: kmer_assembly.dy:296:15: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 296 | fprintf(ofp,"Node %ld of sequence %s \n",node->number,buffer); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly.dy:302:17: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 302 | fprintf(ofp," ... prev ... %c, %d to %ld\n",node->prev[i]->base,node->prev[i]->sequence_label_len,node->prev[i]->prev->number); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly.dy:309:17: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 309 | fprintf(ofp," ... next ... %c, %d to %ld\n",node->next[i]->base,node->next[i]->sequence_label_len,node->next[i]->next->number); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly.dy: In function ‘Wise2_remove_sequence_label_KmerAssemblyLink’: kmer_assembly.dy:365:18: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 4 has type ‘KmerAssemblyLink *’ [-Wformat=] 365 | fprintf(stderr," ...unable to remove label %ld from link %ld (%d labels)\n",label,kal,kal->sequence_label_len); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ | | | KmerAssemblyLink * kmer_assembly.dy:367:20: warning: format ‘%d’ expects a matching ‘int’ argument [-Wformat=] 367 | fprintf(stderr," [%ld] is %d label\n",kal->sequence_label[i]); | ^~~~~~~~~~~~~~~~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models largeseqreader.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_assembly_untangler.c kmer_hash.dy: In function ‘Wise2_free_KmerHashIndex’: kmer_hash.dy:318:19: warning: format ‘%lx’ expects argument of type ‘long unsigned int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 318 | fprintf(stderr, "min_kmer: %016lx\n", khi->min_kmer); | ^~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_hash.dy:319:19: warning: format ‘%lx’ expects argument of type ‘long unsigned int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 319 | fprintf(stderr, "max_kmer: %016lx\n", khi->max_kmer); | ^~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ | | | kmer_t {aka long long int} cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_assembly_contig.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_assembly_error.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models assembly.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models assembly_stream_interface.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models assembly_stream_fasta.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models assembly_sanger_project.c kmer_assembly_untangler.dy: In function ‘Wise2_show_KmerAssemblyPath’: kmer_assembly_untangler.dy:52:65: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] 52 | fprintf(ofp,"%3d memory %d, from [%s] to [%s], base %c\n",i,(int)kap->stack[i],back,forw,kap->stack[i]->base); | ^ kmer_assembly_untangler.dy: In function ‘Wise2_untangle_KmerAssembly’: kmer_assembly_untangler.dy:120:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 120 | fprintf(stderr,"TANGLE: Node %ld, %s has forward %d and back %d links\n",node->number,buffer,node->next_len,node->prev_len); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_untangler.dy:141:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 141 | fprintf(stderr,"Will attempt untangle starting at %ld to %ld\n",node->prev[i]->prev->number,node->number); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_untangler.dy:141:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 4 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 141 | fprintf(stderr,"Will attempt untangle starting at %ld to %ld\n",node->prev[i]->prev->number,node->number); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_untangler.dy:157:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 157 | fprintf(stderr,"RESOLVED: Node %ld [%s] Fully untangled now...\n",node->number,buffer); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_untangler.dy:159:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 159 | fprintf(stderr,"UNRESOLVED: Node %ld [%s] still tangled...\n",node->number,buffer); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_untangler.dy: In function ‘Wise2_old_attempt_forward_untangle_KmerAssembly’: kmer_assembly_untangler.dy:444:20: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 444 | fprintf(stderr,"looking at node %ld with path length %d, next length %d depth %d\n",current->next->number,pathlen,current->next->next_len,current->sequence_label_len); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_untangler.dy:568:82: warning: passing argument 4 of ‘Wise2_lift_backward_tangled_tail’ from incompatible pointer type [-Wincompatible-pointer-types] 568 | lift_backward_tangled_tail(kai,newpath->stack[newpath->stack_len-1],path,transferred_label,transferred_pos,transferred_len); | ^~~~~~~~~~~~~~~~~ | | | long int * In file included from kmer_assembly_untangler.c:4: kmer_assembly_untangler.h:174:116: note: expected ‘int *’ but argument is of type ‘long int *’ 174 | void Wise2_lift_backward_tangled_tail(KmerAssemblyIndex * kai,KmerAssemblyLink * new,KmerAssemblyPath * tail,int * start_label,SinglePosSequence ** positions,int label_len); | ~~~~~~^~~~~~~~~~~ kmer_assembly_untangler.dy: In function ‘Wise2_lift_forward_tangled_KmerAssemblyPath’: kmer_assembly_untangler.dy:746:20: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 6 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 746 | fprintf(stderr,"Moving stack position %d, depth %d, transfer %d, between %ld [%s] and %ld [%s]\n",i,kap->stack[i]->sequence_label_len,label_len,kap->stack[i]->prev->number,back,kap->stack[i]->next->number,forw); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_untangler.dy:746:20: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 8 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 746 | fprintf(stderr,"Moving stack position %d, depth %d, transfer %d, between %ld [%s] and %ld [%s]\n",i,kap->stack[i]->sequence_label_len,label_len,kap->stack[i]->prev->number,back,kap->stack[i]->next->number,forw); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | kmer_t {aka long long int} cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models assembly_stream_cons.c kmer_assembly_error.dy: In function ‘Wise2_mark_tangles_KmerAssembly’: kmer_assembly_error.dy:93:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 93 | fprintf(stderr,"Marking node (%ld) [%s] as next tangled\n",node->number,buffer); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_error.dy:105:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t’ {aka ‘long long int’} [-Wformat=] 105 | fprintf(stderr,"Marking node (%ld) [%s] as prev tangled\n",node->number,buffer); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ | | | kmer_t {aka long long int} kmer_assembly_error.dy: In function ‘Wise2_extend_indel_path_KmerAssembly’: kmer_assembly_error.dy:351:24: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘int *’ [-Wformat=] 351 | fprintf(stderr,"in considering indel (%d, path %d), real (%c) and error (%c) do not agree at position %d,%d\n",delete_length,current_path,real->base,error->base,real_pos,error_pos); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ | | | int * cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models compressed_protein_index.c compressed_protein_index.dy: In function ‘Wise2_add_direct_number_CompressedProteinIndex’: compressed_protein_index.dy:223:10: warning: returning ‘void *’ from a function with return type ‘boolean’ {aka ‘int’} makes integer from pointer without a cast [-Wint-conversion] 223 | return NULL; | ^~~~ make[3]: Leaving directory '/<>/src/dnaindex' (cd network ; make CC="cc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" all ) make[3]: Entering directory '/<>/src/network' cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../socket -I../dynlibsrc -I../dnaindex wise_proteinindex_server.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../socket -I../dynlibsrc -I../dnaindex net_hspscan.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../socket -I../dynlibsrc -I../dnaindex client_multihspscan.c wise_proteinindex_server.c: In function ‘show_version’: wise_proteinindex_server.c:28:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 28 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ cc -g -o scanwise_server wise_proteinindex_server.o net_hspscan.o ../dnaindex/compressed_protein_index.o ../dnaindex/kmer_index_interface.o ../dnaindex/singleseqspace.o ../dnaindex/kmer_direct.o -ldyna_glib -ldyna -lwisesocket -lwisebase -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -g -L../base/ -L../socket -L../dynlibsrc -L../dnaindex -lm `pkg-config --libs glib-2.0` -lpthread make[3]: Leaving directory '/<>/src/network' (cd models ; make CC="cc" CFLAGS="-g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" EXTRALIBS="-lm" HMMER_DEFINE="HMMER_INTERNAL" HMMER_INCLUDE="../HMMer2/" HMMER_LIBS="../HMMer2/" all ) make[3]: Entering directory '/<>/src/models' cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ dnal.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ dnaalign.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ seqaligndisplay.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ psw.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ proteinsw.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ sw_wrap.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ abc.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ pba.c dnal.c: In function ‘show_version’: dnal.c:106:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 106 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ pswdb.c psw.c: In function ‘show_version’: psw.c:261:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 261 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ dbac.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ dba.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ slimdba.c pswdb.c: In function ‘show_version’: pswdb.c:97:106: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 97 | fprintf(stdout,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ dbac.c: In function ‘show_version’: dbac.c:364:33: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 364 | fprintf(ofp," Compiled %s\n",COMPILE_DATE); | ^~~~~~~~~~~~ dbac.c: In function ‘make_SeqAlign_from_align’: dbac.c:413:32: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘size_t’ {aka ‘long unsigned int’} [-Wformat=] 413 | fprintf(stderr,"Got %d with %d vs %d\n",i,strlen(seq),one->len); | ~^ ~~~~~~~~~~~ | | | | int size_t {aka long unsigned int} | %ld cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ bigdba.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ dbadisplay.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include estwise.c -I../base/ -I../dynlibsrc/ -I../HMMer2/ -I. estwise.c: In function ‘show_version’: estwise.c:559:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 559 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ geneparser21.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ geneparameter.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genestats.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genewisehsp.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ geneutil.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ geneoutput.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ threestatemodel.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genefrequency.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ splicesitemodeler.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genewise4.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genewise6.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genestretch6.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genewise21.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ geneloop21.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ geneloop6.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genephase6.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ gwlite.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ gwlitemodel.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ gwrap.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ matchsum.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ estwrap.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genewisemodel.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ phasemodel.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ cdparser.c phasemodel.dy: In function ‘Wise2_read_fasta_PhasedProtein’: phasemodel.dy:241:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 241 | fgets(name,10000,ifp); | ^~~~~~~~~~~~~~~~~~~~~ phasemodel.dy:241:3: warning: ‘fgets’ writing 10000 bytes into a region of size 2000 overflows the destination [-Wstringop-overflow=] 241 | fgets(name,10000,ifp); | ^~~~~~~~~~~~~~~~~~~~~ phasemodel.dy:235:8: note: destination object ‘name’ of size 2000 235 | char name[2000]; | ^~~~ In file included from /usr/include/stdio.h:894, from ../base/wisebase.h:6, from ../dynlibsrc/probability.h:7, from geneparser21.h:6, from genewisemodel.h:6, from phasemodel.h:6, from phasemodel.c:4: /usr/include/riscv64-linux-gnu/bits/stdio2.h:262:1: note: in a call to function ‘fgets’ declared with attribute ‘access (write_only, 1, 2)’ 262 | fgets (char *__restrict __s, int __n, FILE *__restrict __stream) | ^~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genedisplay.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ estwise3.c In function ‘fgets’, inlined from ‘Wise2_read_fasta_PhasedProtein’ at phasemodel.dy:241:3: /usr/include/riscv64-linux-gnu/bits/stdio2.h:268:12: warning: call to ‘__fgets_chk_warn’ declared with attribute warning: fgets called with bigger size than length of destination buffer [-Wattribute-warning] 268 | return __fgets_chk_warn (__s, sz, __n, __stream); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ estslim3.c genedisplay.dy: In function ‘Wise2_write_intron_desc’: genedisplay.dy:493:20: warning: too many arguments for format [-Wformat-extra-args] 493 | sprintf(buffer," Intron ??? ",in_number); | ^~~~~~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ estloop3.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ estfrag3.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ estslimloop.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ gwquickdb.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ threestatedb.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ pfamhmmer1db.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ pwmdna.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../HMMer2/ -DHMMER_INTERNAL -I../base/ -I../dynlibsrc/ wise2xhmmer2.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genewisemodeldb.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ seqhit.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ standardout.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ geneparser4.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ estquick3.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include genewise.c -I../base/ -I../dynlibsrc/ -I../HMMer2/ -I. cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include genewisedb.c -I../base/ -I../dynlibsrc/ -I../HMMer2/ genewise.c: In function ‘show_version’: genewise.c:860:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 860 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ genewisedb.c: In function ‘show_version’: genewisedb.c:1005:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 1005 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include estwisedb.c -I../base/ -I../dynlibsrc/ -I../HMMer2/ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genomewise.c genomewise.c: In function ‘show_version’: genomewise.c:18:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 18 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genomewise9.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genome_evidence.c estwisedb.c: In function ‘show_version’: estwisedb.c:838:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 838 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ est_evidence.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ sywise.c est_evidence.dy: In function ‘Wise2_new_est_GenomeEvidenceUnit’: est_evidence.dy:142:16: warning: assignment to ‘int (*)(void *)’ from incompatible pointer type ‘Wise2_EstEvidence * (*)(Wise2_EstEvidence *)’ [-Wincompatible-pointer-types] 142 | in->geu_free = free_EstEvidence; | ^ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ sywise20.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ syexonmodel.c sywise.c: In function ‘show_version’: sywise.c:14:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 14 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ pseudowise.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ pseudowise7.c pseudowise.c: In function ‘show_version’: pseudowise.c:15:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 15 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ `pkg-config --cflags glib-2.0` promoterwise.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ localdba.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ `pkg-config --cflags glib-2.0` localcishit.c promoterwise.c: In function ‘show_version’: promoterwise.c:17:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 17 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ localcispara.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ motifmatrix.c motifmatrix.c: In function ‘Wise2_MotifConsMatrix_alloc_matrix’: motifmatrix.c:408:24: warning: assignment to ‘char’ from ‘void *’ makes integer from pointer without a cast [-Wint-conversion] 408 | for(i=0;i>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ motifmatrixdp.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ transfactor.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ pairwiseshortdna.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -o scanwisep_wiseserver.o -DSCAN_WISESERVER -I../network -I../socket -I../external/mott scanwisep.c transfactor.dy: In function ‘Wise2_read_ben_IUPAC_TransFactorSet’: transfactor.dy:680:21: warning: ‘%s’ directive writing up to 511 bytes into a region of size between 495 and 504 [-Wformat-overflow=] 680 | sprintf(sbuffer,"motif_%d_%s",motif_no,buffer); | ^~~~~~~~~~~~~ ~~~~~~ In file included from /usr/include/stdio.h:894, from ../base/wisebase.h:6, from pwmdna.h:6, from transfactor.h:6, from transfactor.c:4: In function ‘sprintf’, inlined from ‘Wise2_read_ben_IUPAC_TransFactorSet’ at transfactor.dy:680:5: /usr/include/riscv64-linux-gnu/bits/stdio2.h:38:10: note: ‘__builtin___sprintf_chk’ output between 9 and 529 bytes into a destination of size 512 38 | return __builtin___sprintf_chk (__s, __USE_FORTIFY_LEVEL - 1, | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 39 | __glibc_objsize (__s), __fmt, | ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 40 | __va_arg_pack ()); | ~~~~~~~~~~~~~~~~~ cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/riscv64-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ `pkg-config --cflags glib-2.0` hsp2aln_sw.c scanwisep.c: In function ‘show_version’: scanwisep.c:423:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] 423 | fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); | ^~~~~~~~~~~~ ar ru libmodel.a geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libmodel.a cc -o dnal dnal.o dnaalign.o seqaligndisplay.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm cc -o psw psw.o sw_wrap.o seqaligndisplay.o proteinsw.o abc.o pba.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm cc -o pswdb pswdb.o sw_wrap.o seqaligndisplay.o proteinsw.o abc.o pba.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm cc -o dba dbac.o dba.o slimdba.o bigdba.o dbadisplay.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm cc -g -o estwise estwise.o geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -lhmmer -ldyna_glib -ldyna -lwisebase -lm -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` cc -o genewise genewise.o geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -lhmmer -ldyna_glib -ldyna_glib -ldyna_glib -ldyna -lwisebase -lm -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` cc -g -o genewisedb genewisedb.o geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -lhmmer -ldyna_glib -ldyna -lwisebase -lm -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` cc -g -o estwisedb estwisedb.o geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -lhmmer -ldyna_glib -ldyna -lwisebase -lm -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` cc -o scanwise scanwisep_wiseserver.o sw_wrap.o seqaligndisplay.o proteinsw.o abc.o pba.o hsp2aln_sw.o ../network/net_hspscan.o ../network/client_multihspscan.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -L../external/mott -L../socket -lmott -ldyna_glib -ldyna -lwisesocket -lwisebase -lm -lpthread -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` cc -g -o promoterwise promoterwise.o localdba.o localcishit.o localcispara.o dbadisplay.o motifmatrix.o motifmatrixdp.o transfactor.o pwmdna.o pairwiseshortdna.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm `pkg-config --libs glib-2.0` -lpthread cc -g -o genomewise genomewise.o genomewise9.o genome_evidence.o est_evidence.o geneoutput.o geneutil.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm cc -g -o pseudowise pseudowise.o pseudowise7.o geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -lhmmer -ldyna_glib -ldyna -lwisebase -lm -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` cc -g -o sywise sywise.o sywise20.o syexonmodel.o genestats.o pwmdna.o standardout.o geneutil.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm make[3]: Leaving directory '/<>/src/models' make bin make[3]: Entering directory '/<>/src' mkdir bin cp models/pswdb models/psw models/genewisedb models/estwisedb models/estwise models/genewise models/dba models/dnal models/promoterwise network/scanwise_server models/scanwise ./bin ./welcome.csh Welcome to Wise2.4 The executable programs are in the ./bin directory You must set your WISECONFIGDIR to the config directory before using the programs ie, type setenv WISECONFIGDIR /<>/src/../wisecfg/ to try an example, try cd example and then ../bin/genewise road.pep human.genomic to build perl, type make perl and follow the instructions to test the package, type make test make[3]: Leaving directory '/<>/src' make[2]: Leaving directory '/<>/src' /usr/bin/make -C debian/manpages.d make[2]: Entering directory '/<>/debian/manpages.d' docbook-to-man dba.sgml > dba.1 docbook-to-man dnal.sgml > dnal.1 docbook-to-man estwise.sgml > estwise.1 docbook-to-man estwisedb.sgml > estwisedb.1 docbook-to-man genewise.sgml > genewise.1 docbook-to-man genewisedb.sgml > genewisedb.1 docbook-to-man genomewise.sgml > genomewise.1 docbook-to-man promoterwise.sgml > promoterwise.1 docbook-to-man psw.sgml > psw.1 docbook-to-man pswdb.sgml > pswdb.1 docbook-to-man scanwise.sgml > scanwise.1 docbook-to-man scanwise_server.sgml > scanwise_server.1 make[2]: Leaving directory '/<>/debian/manpages.d' find src/models/ src/dynlibsrc/ -name '*.tex' -print0 | LC_ALL=C sort -z | xargs -0 cat | perl docs/gettex.pl > docs/temp.tex cat docs/wise2api.tex docs/temp.tex docs/apiend.tex > docs/api.tex sed -i 's/ sw_wrap / sw\\_wrap /' docs/api.tex sed -i 's/label{module_sequence\\_codon}/label{module_sequence_codon}/' docs/api.tex sed -i 's/Wise2::GeneParameter21_wrap/Wise2::GeneParameter21\\_wrap/' docs/api.tex cd docs && pdflatex api.tex This is pdfTeX, Version 3.141592653-2.6-1.40.22 (TeX Live 2022/dev/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./api.tex LaTeX2e <2021-11-15> patch level 1 L3 programming layer <2022-01-21> (/usr/share/texlive/texmf-dist/tex/latex/base/latex209.def Entering LaTeX 2.09 COMPATIBILITY MODE ************************************************************* !!WARNING!! !!WARNING!! !!WARNING!! !!WARNING!! This mode attempts to provide an emulation of the LaTeX 2.09 author environment so that OLD documents can be successfully processed. It should NOT be used for NEW documents! New documents should use Standard LaTeX conventions and start with the \documentclass command. Compatibility mode is UNLIKELY TO WORK with LaTeX 2.09 style files that change any internal macros, especially not with those that change the FONT SELECTION or OUTPUT ROUTINES. Therefore such style files MUST BE UPDATED to use Current Standard LaTeX: LaTeX2e. If you suspect that you may be using such a style file, which is probably very, very old by now, then you should attempt to get it updated by sending a copy of this error message to the author of that file. ************************************************************* (/usr/share/texlive/texmf-dist/tex/latex/base/tracefnt.sty) (/usr/share/texlive/texmf-dist/tex/latex/base/latexsym.sty)) (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2021/10/04 v1.4n Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (/usr/share/texlive/texmf-dist/tex/latex/l3backend/l3backend-pdftex.def) No file api.aux. (/usr/share/texlive/texmf-dist/tex/latex/base/ulasy.fd) [1{/var/lib/texmf/fonts /map/pdftex/updmap/pdftex.map}] No file api.toc. [2] [3] Overfull \hbox (1.49698pt too wide) in paragraph at lines 109--109 [] \OT1/cmtt/m/n/10 print "You must give a file to revcom for a reverse to w ork!";[] [4] [5] LaTeX Warning: Reference `object_CodonTable' on page 6 undefined on input line 198. LaTeX Warning: Reference `object_Sequence' on page 6 undefined on input line 19 9. LaTeX Warning: Reference `object_CompMat' on page 6 undefined on input line 205 . LaTeX Warning: Reference `object_Sequence' on page 6 undefined on input line 20 6. LaTeX Warning: Reference `object_Protein' on page 6 undefined on input line 207 . LaTeX Warning: Reference `object_CompMat' on page 6 undefined on input line 208 . LaTeX Warning: Reference `module_sw_wrap' on page 6 undefined on input line 209 . LaTeX Warning: Reference `module_seqaligndisplay' on page 6 undefined on input line 210. LaTeX Warning: Reference `object_Protein' on page 6 undefined on input line 215 . LaTeX Warning: Reference `object_Sequence' on page 6 undefined on input line 21 5. [6] LaTeX Warning: Reference `object_ProteinDB' on page 7 undefined on input line 2 16. LaTeX Warning: Reference `object_ProteinDB' on page 7 undefined on input line 2 17. LaTeX Warning: Reference `module_sw_wrap' on page 7 undefined on input line 218 . LaTeX Warning: Reference `object_Hscore' on page 7 undefined on input line 219. LaTeX Warning: Reference `object_DataEntry' on page 7 undefined on input line 2 21. LaTeX Warning: Reference `object_ProteinDB' on page 7 undefined on input line 2 21. LaTeX Warning: Reference `object_Sequence' on page 7 undefined on input line 22 8. LaTeX Warning: Reference `object_Protein' on page 7 undefined on input line 229 . LaTeX Warning: Reference `object_Sequence' on page 7 undefined on input line 23 0. LaTeX Warning: Reference `object_Genomic' on page 7 undefined on input line 231 . LaTeX Warning: Reference `object_GeneFrequency' on page 7 undefined on input li ne 233. LaTeX Warning: Reference `object_CodonTable' on page 7 undefined on input line 234. LaTeX Warning: Reference `object_RandomModelDNA' on page 7 undefined on input l ine 235. LaTeX Warning: Reference `module_gwrap' on page 7 undefined on input line 236. LaTeX Warning: Reference `module_gwrap' on page 7 undefined on input line 237. Overfull \hbox (21.30891pt too wide) in paragraph at lines 237--238 []\OT1/cmr/m/n/10 Build an en-tire pa-ram-e-ter set for ge-newise us-ing Wise2: :GeneParameter21[]wrap LaTeX Warning: Reference `module_gwrap' on page 7 undefined on input line 238. LaTeX Warning: Reference `module_gwrap' on page 7 undefined on input line 239. [7] [8] [9] LaTeX Warning: Reference `module_gwrap' on page 10 undefined on input line 389. [10] LaTeX Warning: Reference `module_estwrap' on page 11 undefined on input line 39 1. LaTeX Warning: Reference `module_sw_wrap' on page 11 undefined on input line 39 3. LaTeX Warning: Reference `module_genedisplay' on page 11 undefined on input lin e 395. LaTeX Warning: Reference `module_seqaligndisplay' on page 11 undefined on input line 397. LaTeX Warning: Reference `module_threestatemodel' on page 11 undefined on input line 399. LaTeX Warning: Reference `module_threestatedb' on page 11 undefined on input li ne 400. LaTeX Warning: Reference `module_genefrequency' on page 11 undefined on input l ine 401. LaTeX Warning: Reference `module_geneparameter' on page 11 undefined on input l ine 402. LaTeX Warning: Reference `module_cdparser' on page 11 undefined on input line 4 03. LaTeX Warning: Reference `module_sequence' on page 11 undefined on input line 4 10. LaTeX Warning: Reference `module_sequencedb' on page 11 undefined on input line 411. LaTeX Warning: Reference `module_protein' on page 11 undefined on input line 41 2. LaTeX Warning: Reference `module_proteindb' on page 11 undefined on input line 413. LaTeX Warning: Reference `module_genomic' on page 11 undefined on input line 41 4. LaTeX Warning: Reference `module_genomicdb' on page 11 undefined on input line 415. LaTeX Warning: Reference `module_cdna' on page 11 undefined on input line 416. LaTeX Warning: Reference `module_cdnadb' on page 11 undefined on input line 417 . LaTeX Warning: Reference `module_probability' on page 11 undefined on input lin e 423. LaTeX Warning: Reference `module_codon' on page 11 undefined on input line 424. LaTeX Warning: Reference `module_compmat' on page 11 undefined on input line 42 5. LaTeX Warning: Reference `module_codonmat' on page 11 undefined on input line 4 26. LaTeX Warning: Reference `module_codonmapper' on page 11 undefined on input lin e 427. [11] LaTeX Warning: Reference `module_hscore' on page 12 undefined on input line 433 . LaTeX Warning: Reference `module_histogram' on page 12 undefined on input line 434. LaTeX Warning: Reference `module_dbimpl' on page 12 undefined on input line 435 . LaTeX Warning: Reference `module_aln' on page 12 undefined on input line 441. LaTeX Warning: Reference `module_packaln' on page 12 undefined on input line 44 2. LaTeX Warning: Reference `module_basematrix' on page 12 undefined on input line 443. LaTeX Warning: Reference `object_AlnBlock' on page 12 undefined on input line 4 51. LaTeX Warning: Reference `object_AlnColumn' on page 12 undefined on input line 453. LaTeX Warning: Reference `object_AlnUnit' on page 12 undefined on input line 45 5. LaTeX Warning: Reference `object_AlnSequence' on page 12 undefined on input lin e 457. LaTeX Warning: Reference `accessing_fields' on page 12 undefined on input line 464. Overfull \hbox (6.8248pt too wide) in paragraph at lines 475--482 \OT1/cmr/m/n/10 AlnBlock is the main rep-re-sen-ta-tion of align-ments from Dy- na-mite. Each AlnBlock [12] (/usr/share/texlive/texmf-dist/tex/latex/base/ts1cmtt.fd) LaTeX Warning: Reference `accessing_fields' on page 13 undefined on input line 513. [13] LaTeX Warning: Reference `accessing_fields' on page 14 undefined on input line 555. [14] LaTeX Warning: Reference `accessing_fields' on page 15 undefined on input line 623. [15] LaTeX Warning: Reference `object_AlnRange' on page 16 undefined on input line 6 52. LaTeX Warning: Reference `object_AlnRangeSet' on page 16 undefined on input lin e 654. LaTeX Warning: Reference `accessing_fields' on page 16 undefined on input line 661. LaTeX Warning: Reference `accessing_fields' on page 16 undefined on input line 688. [16] LaTeX Warning: Reference `object_cDNA' on page 17 undefined on input line 741. LaTeX Warning: Reference `accessing_fields' on page 17 undefined on input line 748. [17] [18] [19] LaTeX Warning: Reference `object_cDNADB' on page 20 undefined on input line 884 . LaTeX Warning: Reference `accessing_fields' on page 20 undefined on input line 924. [20] LaTeX Warning: Reference `object_CodonTable' on page 21 undefined on input line 1005. [21] [22] [23] [24] LaTeX Warning: Reference `accessing_fields' on page 25 undefined on input line 1213. [25] [26] [27] LaTeX Warning: Reference `object_CodonMapper' on page 28 undefined on input lin e 1363. LaTeX Warning: Reference `accessing_fields' on page 28 undefined on input line 1391. [28] Overfull \hbox (12.33003pt too wide) in paragraph at lines 1418--1419 []\OT1/cmtt/m/n/10 &Wise2::CodonMapper::sprinkle[]errors[]over[]CodonMapper (cm ,error) LaTeX Warning: Reference `object_ComplexSequence' on page 29 undefined on input line 1442. LaTeX Warning: Reference `object_ComplexSequenceEvalSet' on page 29 undefined o n input line 1444. LaTeX Warning: Reference `accessing_fields' on page 29 undefined on input line 1451. [29] LaTeX Warning: Reference `accessing_fields' on page 30 undefined on input line 1482. LaTeX Warning: Reference `object_CompMat' on page 30 undefined on input line 15 17. LaTeX Warning: Reference `accessing_fields' on page 30 undefined on input line 1524. [30] [31] LaTeX Warning: Reference `object_DBSearchImpl' on page 32 undefined on input li ne 1624. [32] LaTeX Warning: Reference `accessing_fields' on page 33 undefined on input line 1671. [33] LaTeX Warning: Reference `object_DnaMatrix' on page 34 undefined on input line 1736. LaTeX Warning: Reference `object_DnaProbMatrix' on page 34 undefined on input l ine 1738. [34] LaTeX Warning: Reference `accessing_fields' on page 35 undefined on input line 1799. LaTeX Warning: Reference `accessing_fields' on page 35 undefined on input line 1812. [35] LaTeX Warning: Reference `object_Gene' on page 36 undefined on input line 1844. LaTeX Warning: Reference `accessing_fields' on page 36 undefined on input line 1851. [36] [37] LaTeX Warning: Reference `object_Genomic' on page 38 undefined on input line 19 48. LaTeX Warning: Reference `object_GenomicRepeat' on page 38 undefined on input l ine 1950. [38] Overfull \hbox (0.5938pt too wide) in paragraph at lines 1989--1990 []\OT1/cmtt/m/n/10 Wise2[]Genomic[]from[]Sequence[]Nheuristic (seq,length[]of[] N) LaTeX Warning: Reference `accessing_fields' on page 39 undefined on input line 2038. [39] [40] LaTeX Warning: Reference `accessing_fields' on page 41 undefined on input line 2150. [41] LaTeX Warning: Reference `object_GenomicDB' on page 42 undefined on input line 2168. Overfull \hbox (65.9032pt too wide) in paragraph at lines 2175--2176 []\OT1/cmtt/m/n/10 Wise2[]new[]GenomicDB[]from[]single[]seq (gen,cses,score[]in []repeat[]coding) Overfull \hbox (43.1997pt too wide) in paragraph at lines 2176--2177 []\OT1/cmtt/m/n/10 &Wise2::new[]GenomicDB[]from[]single[]seq (gen,cses,score[]i n[]repeat[]coding) Overfull \hbox (41.12343pt too wide) in paragraph at lines 2192--2193 []\OT1/cmtt/m/n/10 Wise2[]new[]GenomicDB (seqdb,cses,length[]of[]N,repeat[]in[] cds[]score) Overfull \hbox (18.41994pt too wide) in paragraph at lines 2193--2194 []\OT1/cmtt/m/n/10 &Wise2::new[]GenomicDB (seqdb,cses,length[]of[]N,repeat[]in[ ]cds[]score) [42] LaTeX Warning: Reference `accessing_fields' on page 43 undefined on input line 2213. [43] LaTeX Warning: Reference `object_GenomicRegion' on page 44 undefined on input l ine 2298. LaTeX Warning: Reference `accessing_fields' on page 44 undefined on input line 2305. [44] Overfull \hbox (1.83012pt too wide) in paragraph at lines 2348--2349 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::read[]EMBL[]GenomicRegion[]file (file name) [45] Overfull \hbox (7.08008pt too wide) in paragraph at lines 2401--2402 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::show[]ace[]GenomicRegion (gr,seq[]nam e,ofp) Overfull \hbox (3.5338pt too wide) in paragraph at lines 2426--2427 []\OT1/cmtt/m/n/10 Wise2[]show[]pretty[]GenomicRegion (gr,show[]supporting,ofp) Overfull \hbox (59.57962pt too wide) in paragraph at lines 2427--2428 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::show[]pretty[]GenomicRegion (gr,show[ ]supporting,ofp) [46] [47] LaTeX Warning: Reference `object_Histogram' on page 48 undefined on input line 2505. [48] LaTeX Warning: Reference `accessing_fields' on page 49 undefined on input line 2553. Overfull \hbox (32.9967pt too wide) in paragraph at lines 2592--2592 [] \OT1/cmtt/m/n/10 b) cooperation with future versions of histogram.c would be possible.[] [49] [50] [51] Overfull \hbox (123.4428pt too wide) in paragraph at lines 2794--2795 []\OT1/cmtt/m/n/10 Wise2[]ExtremeValueSetHistogram (h,mu,lambda,lowbound,highbo und,wonka,ndegrees) Overfull \hbox (67.76958pt too wide) in paragraph at lines 2795--2796 []\OT1/cmtt/m/n/10 &Wise2::Histogram::set[]EVD (h,mu,lambda,lowbound,highbound, wonka,ndegrees) Overfull \hbox (33.66461pt too wide) in paragraph at lines 2797--2798 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->set[]EVD(mu,lambda,lowbound,highbound ,wonka,ndegrees) [52] [53] [54] LaTeX Warning: Reference `object_Hscore' on page 55 undefined on input line 293 0. LaTeX Warning: Reference `object_DataScore' on page 55 undefined on input line 2932. LaTeX Warning: Reference `object_DataEntry' on page 55 undefined on input line 2934. LaTeX Warning: Reference `accessing_fields' on page 55 undefined on input line 2961. Overfull \hbox (30.97293pt too wide) in paragraph at lines 2971--2972 []\OT1/cmr/m/n/10 should[]store Type [boolean (*should[]store)(int given[]score ,double in-ter-nal[]score[]level) [55] [56] [57] LaTeX Warning: Reference `accessing_fields' on page 58 undefined on input line 3162. [58] LaTeX Warning: Reference `accessing_fields' on page 59 undefined on input line 3188. LaTeX Warning: Reference `object_PackAln' on page 59 undefined on input line 32 29. [59] LaTeX Warning: Reference `object_PackAlnUnit' on page 60 undefined on input lin e 3231. LaTeX Warning: Reference `accessing_fields' on page 60 undefined on input line 3238. [60] LaTeX Warning: Reference `accessing_fields' on page 61 undefined on input line 3308. [61] [62] LaTeX Warning: Reference `object_Protein' on page 63 undefined on input line 34 31. LaTeX Warning: Reference `accessing_fields' on page 63 undefined on input line 3438. [63] LaTeX Warning: Reference `object_ProteinDB' on page 64 undefined on input line 3488. LaTeX Warning: Reference `accessing_fields' on page 64 undefined on input line 3545. [64] LaTeX Warning: Reference `object_RandomProteinDB' on page 65 undefined on input line 3590. LaTeX Warning: Reference `object_RandomDNADB' on page 65 undefined on input lin e 3592. LaTeX Warning: Reference `accessing_fields' on page 65 undefined on input line 3599. LaTeX Warning: Reference `accessing_fields' on page 65 undefined on input line 3620. [65] LaTeX Warning: Reference `object_RandomModelDNA' on page 66 undefined on input line 3642. LaTeX Warning: Reference `object_RandomModel' on page 66 undefined on input lin e 3644. LaTeX Warning: Reference `accessing_fields' on page 66 undefined on input line 3682. [66] LaTeX Warning: Reference `accessing_fields' on page 67 undefined on input line 3697. LaTeX Warning: Reference `object_Sequence' on page 67 undefined on input line 3 713. LaTeX Warning: Reference `object_SequenceSet' on page 67 undefined on input lin e 3715. [67] LaTeX Warning: Reference `accessing_fields' on page 68 undefined on input line 3779. [68] Overfull \hbox (16.34366pt too wide) in paragraph at lines 3839--3840 []\OT1/cmtt/m/n/10 Wise2[]force[]to[]dna[]Sequence (seq,fraction,number[]of[]co nver) [69] [70] [71] [72] [73] [74] LaTeX Warning: Reference `accessing_fields' on page 75 undefined on input line 4176. [75] [76] LaTeX Warning: Reference `object_SequenceDB' on page 77 undefined on input line 4265. LaTeX Warning: Reference `object_FileSource' on page 77 undefined on input line 4267. LaTeX Warning: Reference `accessing_fields' on page 77 undefined on input line 4294. [77] LaTeX Warning: Reference `accessing_fields' on page 78 undefined on input line 4355. LaTeX Warning: Reference `object_Exon' on page 78 undefined on input line 4381. LaTeX Warning: Reference `object_Transcript' on page 78 undefined on input line 4383. [78] LaTeX Warning: Reference `accessing_fields' on page 79 undefined on input line 4390. LaTeX Warning: Reference `accessing_fields' on page 79 undefined on input line 4413. [79] LaTeX Warning: Reference `object_Translation' on page 80 undefined on input lin e 4482. LaTeX Warning: Reference `accessing_fields' on page 80 undefined on input line 4489. Overfull \hbox (24.01358pt too wide) in paragraph at lines 4508--4515 \OT1/cmr/m/n/10 have any se-quence in it. When se-quence is asked for by get[]P rotein[]from[]Translation() [80] LaTeX Warning: Reference `object_cDNAParser' on page 81 undefined on input line 4549. [81] LaTeX Warning: Reference `accessing_fields' on page 82 undefined on input line 4579. LaTeX Warning: Reference `object_DnaStartEnd' on page 82 undefined on input lin e 4602. Overfull \hbox (62.7533pt too wide) in paragraph at lines 4609--4610 []\OT1/cmtt/m/n/10 Wise2[]make[]align[]dnaalign (one,two,mat,se,qgap,qext,tgap, text,dpri) Overfull \hbox (40.0498pt too wide) in paragraph at lines 4610--4611 []\OT1/cmtt/m/n/10 &Wise2::make[]align[]dnaalign (one,two,mat,se,qgap,qext,tgap ,text,dpri) [82] LaTeX Warning: Reference `accessing_fields' on page 83 undefined on input line 4655. Overfull \hbox (335.96082pt too wide) in paragraph at lines 4671--4672 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]TSM[]estwise (tdb,cdb,cp,cm,rmd,use[]sy n,alg,bits[]cutoff,allN,flat[]insert,report[]level,die[]on[]error,dbsi) Overfull \hbox (313.25732pt too wide) in paragraph at lines 4672--4673 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]TSM[]estwise (tdb,cdb,cp,cm,rmd,use[]s yn,alg,bits[]cutoff,allN,flat[]insert,report[]level,die[]on[]error,dbsi) [83] Overfull \hbox (329.87091pt too wide) in paragraph at lines 4698--4699 []\OT1/cmtt/m/n/10 Wise2[]AlnBlock[]from[]Protein[]estwise[]wrap (pro,cdna,cp,c m,ct,comp,gap,ext,is[]global,rmd,alg,rm,use[]syn,allN,dpri,palpoi) Overfull \hbox (270.41774pt too wide) in paragraph at lines 4699--4700 []\OT1/cmtt/m/n/10 &Wise2::AlnBlock[]from[]Protein[]estwise[]wrap (pro,cdna,cp, cm,ct,comp,gap,ext,is[]global,rmd,alg,rm,use[]syn,allN,dpri) [84] Overfull \hbox (265.40146pt too wide) in paragraph at lines 4732--4733 []\OT1/cmtt/m/n/10 Wise2[]AlnBlock[]from[]TSM[]estwise[]wrap (tsm,cdna,cp,cm,ct ,rmd,alg,use[]syn,force[]flat[]insert,allN,dpri,palpoi) Overfull \hbox (205.94829pt too wide) in paragraph at lines 4733--4734 []\OT1/cmtt/m/n/10 &Wise2::AlnBlock[]from[]TSM[]estwise[]wrap (tsm,cdna,cp,cm,c t,rmd,alg,use[]syn,force[]flat[]insert,allN,dpri) [85] Overfull \hbox (47.00343pt too wide) in paragraph at lines 4780--4781 []\OT1/cmtt/m/n/10 Wise2[]protein2genomic[]ascii[]display (alb,p,gen,ct,name,ma in,ofp) Overfull \hbox (24.29994pt too wide) in paragraph at lines 4781--4782 []\OT1/cmtt/m/n/10 &Wise2::protein2genomic[]ascii[]display (alb,p,gen,ct,name,m ain,ofp) [86] Overfull \hbox (188.7522pt too wide) in paragraph at lines 4801--4802 []\OT1/cmtt/m/n/10 Wise2[]protcdna[]ascii[]display (alb,protsequence,protname,p rotoff,cdna,ct,name,main,mult,ofp) Overfull \hbox (166.0487pt too wide) in paragraph at lines 4802--4803 []\OT1/cmtt/m/n/10 &Wise2::protcdna[]ascii[]display (alb,protsequence,protname, protoff,cdna,ct,name,main,mult,ofp) LaTeX Warning: Reference `object_GeneFrequency21' on page 87 undefined on input line 4830. LaTeX Warning: Reference `object_GeneConsensus' on page 87 undefined on input l ine 4832. LaTeX Warning: Reference `object_GeneSingleCons' on page 87 undefined on input line 4834. [87] LaTeX Warning: Reference `accessing_fields' on page 88 undefined on input line 4879. Overfull \hbox (1.40793pt too wide) in paragraph at lines 4893--4894 []\OT1/cmr/m/n/10 transition[GENEFREQUENCY21[]TRANSITION[]LEN] Type [dou-ble : Scalar] LaTeX Warning: Reference `accessing_fields' on page 88 undefined on input line 4906. [88] LaTeX Warning: Reference `accessing_fields' on page 89 undefined on input line 4921. LaTeX Warning: Reference `object_GeneParameter21' on page 89 undefined on input line 4937. LaTeX Warning: Reference `accessing_fields' on page 89 undefined on input line 4944. [89] LaTeX Warning: Reference `object_MatchSummarySet' on page 90 undefined on input line 4990. LaTeX Warning: Reference `object_MatchSummary' on page 90 undefined on input li ne 4992. LaTeX Warning: Reference `accessing_fields' on page 90 undefined on input line 4999. Overfull \hbox (71.7832pt too wide) in paragraph at lines 5014--5015 []\OT1/cmtt/m/n/10 Wise2[]MatchSummarySet[]from[]AlnBlock[]estwise (alb,qname,o ffset,target) Overfull \hbox (1.83012pt too wide) in paragraph at lines 5015--5016 []\OT1/cmtt/m/n/10 &Wise2::MatchSummarySet::MatchSummarySet[]from[]AlnBlock[]es twise Overfull \hbox (62.22433pt too wide) in paragraph at lines 5017--5018 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->MatchSummarySet[]from[]AlnBlock[]estw ise(qname,offset,target) [90] Overfull \hbox (82.28311pt too wide) in paragraph at lines 5040--5041 []\OT1/cmtt/m/n/10 Wise2[]MatchSummarySet[]from[]AlnBlock[]genewise (alb,qname, protoff,target) Overfull \hbox (7.08008pt too wide) in paragraph at lines 5041--5042 []\OT1/cmtt/m/n/10 &Wise2::MatchSummarySet::MatchSummarySet[]from[]AlnBlock[]ge newise Overfull \hbox (72.72424pt too wide) in paragraph at lines 5043--5044 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->MatchSummarySet[]from[]AlnBlock[]gene wise(qname,protoff,target) LaTeX Warning: Reference `accessing_fields' on page 91 undefined on input line 5065. [91] LaTeX Warning: Reference `object_PfamHmmer1DB' on page 92 undefined on input li ne 5107. LaTeX Warning: Reference `object_PfamHmmer1Entry' on page 92 undefined on input line 5109. LaTeX Warning: Reference `accessing_fields' on page 92 undefined on input line 5116. LaTeX Warning: Reference `accessing_fields' on page 92 undefined on input line 5152. [92] Overfull \hbox (92.78302pt too wide) in paragraph at lines 5174--5175 []\OT1/cmtt/m/n/10 Wise2[]write[]pretty[]str[]align (alb,qname,query,tname,targ et,name,main,ofp) Overfull \hbox (70.07953pt too wide) in paragraph at lines 5175--5176 []\OT1/cmtt/m/n/10 &Wise2::write[]pretty[]str[]align (alb,qname,query,tname,tar get,name,main,ofp) [93] Overfull \hbox (3.5338pt too wide) in paragraph at lines 5217--5218 []\OT1/cmtt/m/n/10 Wise2[]write[]pretty[]Protein[]align (alb,q,t,name,main,ofp) LaTeX Warning: Reference `object_DnaSequenceHitList' on page 94 undefined on in put line 5243. LaTeX Warning: Reference `object_SegmentHitList' on page 94 undefined on input line 5245. LaTeX Warning: Reference `object_SegmentHit' on page 94 undefined on input line 5247. [94] LaTeX Warning: Reference `accessing_fields' on page 95 undefined on input line 5254. Overfull \hbox (29.5499pt too wide) in paragraph at lines 5290--5291 []\OT1/cmtt/m/n/10 &Wise2::DnaSequenceHitList::read[]MSPcrunch[]DnaSequenceHitL ist (ifp) [95] LaTeX Warning: Reference `accessing_fields' on page 96 undefined on input line 5307. LaTeX Warning: Reference `accessing_fields' on page 96 undefined on input line 5320. Overfull \hbox (99.50298pt too wide) in paragraph at lines 5348--5349 []\OT1/cmtt/m/n/10 Wise2[]Align[]strings[]ProteinSmithWaterman (one,two,comp,ga p,ext,dpenv,dpri) Overfull \hbox (76.79948pt too wide) in paragraph at lines 5349--5350 []\OT1/cmtt/m/n/10 &Wise2::Align[]strings[]ProteinSmithWaterman (one,two,comp,g ap,ext,dpenv,dpri) [96] Overfull \hbox (110.00288pt too wide) in paragraph at lines 5373--5374 []\OT1/cmtt/m/n/10 Wise2[]Align[]Sequences[]ProteinSmithWaterman (one,two,comp, gap,ext,dpenv,dpri) Overfull \hbox (87.2994pt too wide) in paragraph at lines 5374--5375 []\OT1/cmtt/m/n/10 &Wise2::Align[]Sequences[]ProteinSmithWaterman (one,two,comp ,gap,ext,dpenv,dpri) Overfull \hbox (7.58401pt too wide) in paragraph at lines 5386--5387 []\OT1/cmr/m/n/10 [OWNER] new AlnBlock struc-ture rep-re-sent-ing the align-men t [AlnBlock [97] Overfull \hbox (68.00325pt too wide) in paragraph at lines 5407--5408 []\OT1/cmtt/m/n/10 Wise2[]Align[]Proteins[]SmithWaterman (one,two,comp,gap,ext, dpenv,dpri) Overfull \hbox (45.29976pt too wide) in paragraph at lines 5408--5409 []\OT1/cmtt/m/n/10 &Wise2::Align[]Proteins[]SmithWaterman (one,two,comp,gap,ext ,dpenv,dpri) Overfull \hbox (5.0038pt too wide) in paragraph at lines 5434--5435 []\OT1/cmtt/m/n/10 Wise2[]Align[]Proteins[]ABC (one,two,comp,a,b,c,dpenv,dpri) [98] Overfull \hbox (47.00343pt too wide) in paragraph at lines 5455--5456 []\OT1/cmtt/m/n/10 Wise2[]Align[]Sequences[]ProteinABC (one,two,comp,a,b,c,dpen v,dpri) Overfull \hbox (24.29994pt too wide) in paragraph at lines 5456--5457 []\OT1/cmtt/m/n/10 &Wise2::Align[]Sequences[]ProteinABC (one,two,comp,a,b,c,dpe nv,dpri) Overfull \hbox (86.01088pt too wide) in paragraph at lines 5471--5474 \OT1/cmr/m/n/10 Align[]Sequences[]ProteinABC this func-tion is anal-o-gous to A lign[]Sequences[]ProteinSmithWaterman Overfull \hbox (240.62169pt too wide) in paragraph at lines 5478--5479 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinSW (querydb,targetdb,comp,gap,ex t,bits[]cutoff,report[]level,die[]on[]error,dbsi) Overfull \hbox (217.9182pt too wide) in paragraph at lines 5479--5480 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinSW (querydb,targetdb,comp,gap,e xt,bits[]cutoff,report[]level,die[]on[]error,dbsi) [99] Overfull \hbox (235.37173pt too wide) in paragraph at lines 5500--5501 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinABC (querydb,targetdb,comp,a,b,c ,bits[]cutoff,report[]level,die[]on[]error,dbsi) Overfull \hbox (212.66824pt too wide) in paragraph at lines 5501--5502 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinABC (querydb,targetdb,comp,a,b, c,bits[]cutoff,report[]level,die[]on[]error,dbsi) [100] Overfull \hbox (359.90063pt too wide) in paragraph at lines 5523--5524 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinBA (querydb,targetdb,comp,bentry ,bexit,bfor[]trans,b[]self[]trans,b3exit,bits[]cutoff,report[]level,dbsi) Overfull \hbox (337.19714pt too wide) in paragraph at lines 5524--5525 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinBA (querydb,targetdb,comp,bentr y,bexit,bfor[]trans,b[]self[]trans,b3exit,bits[]cutoff,report[]level,dbsi) LaTeX Warning: Reference `object_ThreeStateDB' on page 101 undefined on input l ine 5552. LaTeX Warning: Reference `accessing_fields' on page 101 undefined on input line 5559. [101] Overfull \hbox (15.42177pt too wide) in paragraph at lines 5587--5588 []\OT1/cmr/m/n/10 reload[]generic Type [Three-State-Model * (*reload[]generic)( ThreeStateDB * tdb,int Overfull \hbox (3.42192pt too wide) in paragraph at lines 5594--5595 []\OT1/cmr/m/n/10 dataentry[]add Type [boolean (*dataen-try[]add)(ThreeStateDB * tdb,DataEntry Overfull \hbox (41.78299pt too wide) in paragraph at lines 5598--5599 []\OT1/cmr/m/n/10 index[]generic Type [Three-State-Model * (*in-dex[]generic)(T hreeStateDB *tdb,DataEntry [102] Overfull \hbox (29.5499pt too wide) in paragraph at lines 5669--5670 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateDB::new[]proteindb[]ThreeStateDB (sdb,comp ,gap,ext) [103] [104] LaTeX Warning: Reference `object_ThreeStateModel' on page 105 undefined on inpu t line 5732. LaTeX Warning: Reference `object_ThreeStateUnit' on page 105 undefined on input line 5734. LaTeX Warning: Reference `accessing_fields' on page 105 undefined on input line 5775. [105] Overfull \hbox (16.10999pt too wide) in paragraph at lines 5802--5803 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::force[]global[]model (tsm,prob[]int o[]model) Overfull \hbox (102.65288pt too wide) in paragraph at lines 5822--5823 []\OT1/cmtt/m/n/10 Wise2[]force[]weighted[]local[]model (tsm,prob[]into[]model, ratio[]start,ratio[]end) Overfull \hbox (169.19861pt too wide) in paragraph at lines 5823--5824 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::force[]weighted[]local[]model (tsm, prob[]into[]model,ratio[]start,ratio[]end) Overfull \hbox (93.09401pt too wide) in paragraph at lines 5825--5826 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->force[]weighted[]local[]model(prob[]i nto[]model,ratio[]start,ratio[]end) Overfull \hbox (49.31339pt too wide) in paragraph at lines 5845--5846 []\OT1/cmtt/m/n/10 Wise2[]ThreeStateModel[]from[]half[]bit[]Sequence (pro,mat,r m,gap,ext) [106] Overfull \hbox (5.61008pt too wide) in paragraph at lines 5846--5847 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::ThreeStateModel[]from[]half[]bit[]S equence Overfull \hbox (39.75452pt too wide) in paragraph at lines 5848--5849 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->ThreeStateModel[]from[]half[]bit[]Seq uence(mat,rm,gap,ext) Overfull \hbox (51.38966pt too wide) in paragraph at lines 5872--5873 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::write[]HMMer[]1[]7[]ascii[]ThreeSta teModel (tsm,ofp) LaTeX Warning: Reference `accessing_fields' on page 107 undefined on input line 5890. [107] [108] (./api.aux) kpathsea: Running mktexpk --mfmode / --bdpi 600 --mag 1+0/600 --dpi 600 tctt1000 mkdir: cannot create directory ‘././sbuild-nonexistent’: Permission denied mktexpk: Running mf-nowin -progname=mf \mode:=ljfour; mag:=1+0/600; nonstopmode; input tctt1000 This is METAFONT, Version 2.71828182 (TeX Live 2022/dev/Debian) (preloaded base=mf) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/tctt1000.mf (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/exbase.mf) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/tctt.mf (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txsymb.mf Ok (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/exaccess.mf Ok) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txpseudo.mf Ok) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txaccent.mf Ok [0] [1] [2] [3] [4] [5] [6] [7] [8] [9] [10] [11] [12] [27] [29]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txgen.mf Ok [100] [109] [98] [99] [108]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txsymbol.mf Ok [13] [18] [21] [22] [23] [24] [25] [26] [28] [31] [32] [36] [39] [44] [45] [46] [42] [47] [60] [61] [62] [77] [79] [87] [110] [91] [93] [94] [95] [96] [126] [127] [128] [129] [130] [131] [132] [133] [134] [135] [136] [137] [138] [139] [140] [141] [142] [143] [144] [145] [146] [147] [148] [149] [150] [151] [152] [153] [154] [155] [156] [157] [158] [159] [160] [161] [162] [163] [164] [165] [166] [167] [168] [169] [171] [172] [173] [174] [175] [177] [176] [180] [181] [182] [183] [184] [187] [191] [214] [246]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txromod.mf Ok [48] [49] [50] [51] [52] [53] [54] [55] [56] [57]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txrsuper.mf Ok [185] [178] [179] [170] [186]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txrfract.mf Ok [188] [189] [190]) ) ) ) Font metrics written on tctt1000.tfm. Output written on tctt1000.600gf (128 characters, 19540 bytes). Transcript written on tctt1000.log. mktexpk: /tmp/texfonts/pk/ljfour/jknappen/ec/tctt1000.600pk: successfully generated. LaTeX Warning: There were undefined references. LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) kpathsea: Running mktexpk --mfmode / --bdpi 600 --mag 1+0/600 --dpi 600 tcrm1000 mkdir: cannot create directory ‘././sbuild-nonexistent’: Permission denied mktexpk: Running mf-nowin -progname=mf \mode:=ljfour; mag:=1+0/600; nonstopmode; input tcrm1000 This is METAFONT, Version 2.71828182 (TeX Live 2022/dev/Debian) (preloaded base=mf) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/tcrm1000.mf (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/exbase.mf) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/tcrm.mf (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txsymb.mf Ok (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/exaccess.mf Ok) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txpseudo.mf Ok) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txaccent.mf Ok [0] [1] [2] [3] [4] [5] [6] [7] [8] [9] [10] [11] [12] [27] [29]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txgen.mf Ok [100] [109] [98] [99] [108]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txsymbol.mf Ok [13] [18] [21] [22] [23] [24] [25] [26] [28] [31] [32] [36] [39] [44] [45] [46] [42] [47] [60] [61] [62] [77] [79] [87] [110] [91] [93] [94] [95] [96] [126] [127] [128] [129] [130] [131] [132] [133] [134] [135] [136] [137] [138] [139] [140] [141] [142] [143] [144] [145] [146] [147] [148] [149] [150] [151] [152] [153] [154] [155] [156] [157] [158] [159] [160] [161] [162] [163] [164] [165] [166] [167] [168] [169] [171] [172] [173] [174] [175] [177] [176] [180] [181] [182] [183] [184] [187] [191] [214] [246]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txromod.mf Ok [48] [49] [50] [51] [52] [53] [54] [55] [56] [57]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txrsuper.mf Ok [185] [178] [179] [170] [186]) (/usr/share/texlive/texmf-dist/fonts/source/jknappen/ec/txrfract.mf Ok [188] [189] [190]) ) ) ) (some charht values had to be adjusted by as much as 0.06943pt) Font metrics written on tcrm1000.tfm. Output written on tcrm1000.600gf (128 characters, 23548 bytes). Transcript written on tcrm1000.log. mktexpk: /tmp/texfonts/pk/ljfour/jknappen/ec/tcrm1000.600pk: successfully generated. Output written on api.pdf (108 pages, 304124 bytes). Transcript written on api.log. cd docs && pdflatex api.tex This is pdfTeX, Version 3.141592653-2.6-1.40.22 (TeX Live 2022/dev/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./api.tex LaTeX2e <2021-11-15> patch level 1 L3 programming layer <2022-01-21> (/usr/share/texlive/texmf-dist/tex/latex/base/latex209.def Entering LaTeX 2.09 COMPATIBILITY MODE ************************************************************* !!WARNING!! !!WARNING!! !!WARNING!! !!WARNING!! This mode attempts to provide an emulation of the LaTeX 2.09 author environment so that OLD documents can be successfully processed. It should NOT be used for NEW documents! New documents should use Standard LaTeX conventions and start with the \documentclass command. Compatibility mode is UNLIKELY TO WORK with LaTeX 2.09 style files that change any internal macros, especially not with those that change the FONT SELECTION or OUTPUT ROUTINES. Therefore such style files MUST BE UPDATED to use Current Standard LaTeX: LaTeX2e. If you suspect that you may be using such a style file, which is probably very, very old by now, then you should attempt to get it updated by sending a copy of this error message to the author of that file. ************************************************************* (/usr/share/texlive/texmf-dist/tex/latex/base/tracefnt.sty) (/usr/share/texlive/texmf-dist/tex/latex/base/latexsym.sty)) (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2021/10/04 v1.4n Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (/usr/share/texlive/texmf-dist/tex/latex/l3backend/l3backend-pdftex.def) (./api.aux) (/usr/share/texlive/texmf-dist/tex/latex/base/ulasy.fd) [1{/var/lib /texmf/fonts/map/pdftex/updmap/pdftex.map}] (./api.toc [2] [3] [4] [5] [6] [7] [8] [9]) [10] [11] Overfull \hbox (1.49698pt too wide) in paragraph at lines 109--109 [] \OT1/cmtt/m/n/10 print "You must give a file to revcom for a reverse to w ork!";[] [12] [13] [14] LaTeX Warning: Reference `object_GeneFrequency' on page 15 undefined on input l ine 233. LaTeX Warning: Reference `module_gwrap' on page 15 undefined on input line 236. LaTeX Warning: Reference `module_gwrap' on page 15 undefined on input line 237. Overfull \hbox (21.30891pt too wide) in paragraph at lines 237--238 []\OT1/cmr/m/n/10 Build an en-tire pa-ram-e-ter set for ge-newise us-ing Wise2: :GeneParameter21[]wrap LaTeX Warning: Reference `module_gwrap' on page 15 undefined on input line 238. LaTeX Warning: Reference `module_gwrap' on page 15 undefined on input line 239. [15] [16] [17] LaTeX Warning: Reference `module_gwrap' on page 18 undefined on input line 389. [18] LaTeX Warning: Reference `module_codonmat' on page 19 undefined on input line 4 26. [19] LaTeX Warning: Reference `module_dbimpl' on page 20 undefined on input line 435 . Overfull \hbox (6.8248pt too wide) in paragraph at lines 475--482 \OT1/cmr/m/n/10 AlnBlock is the main rep-re-sen-ta-tion of align-ments from Dy- na-mite. Each AlnBlock [20] (/usr/share/texlive/texmf-dist/tex/latex/base/ts1cmtt.fd) [21] [22] [23] [24] [25] [26] [27] [28] [29] [30] [31] [32] [33] [34] [35] [36] Overfull \hbox (12.33003pt too wide) in paragraph at lines 1418--1419 []\OT1/cmtt/m/n/10 &Wise2::CodonMapper::sprinkle[]errors[]over[]CodonMapper (cm ,error) [37] [38] [39] [40] [41] [42] [43] [44] [45] [46] Overfull \hbox (0.5938pt too wide) in paragraph at lines 1989--1990 []\OT1/cmtt/m/n/10 Wise2[]Genomic[]from[]Sequence[]Nheuristic (seq,length[]of[] N) [47] [48] [49] Overfull \hbox (65.9032pt too wide) in paragraph at lines 2175--2176 []\OT1/cmtt/m/n/10 Wise2[]new[]GenomicDB[]from[]single[]seq (gen,cses,score[]in []repeat[]coding) Overfull \hbox (43.1997pt too wide) in paragraph at lines 2176--2177 []\OT1/cmtt/m/n/10 &Wise2::new[]GenomicDB[]from[]single[]seq (gen,cses,score[]i n[]repeat[]coding) Overfull \hbox (41.12343pt too wide) in paragraph at lines 2192--2193 []\OT1/cmtt/m/n/10 Wise2[]new[]GenomicDB (seqdb,cses,length[]of[]N,repeat[]in[] cds[]score) Overfull \hbox (18.41994pt too wide) in paragraph at lines 2193--2194 []\OT1/cmtt/m/n/10 &Wise2::new[]GenomicDB (seqdb,cses,length[]of[]N,repeat[]in[ ]cds[]score) [50] [51] [52] Overfull \hbox (1.83012pt too wide) in paragraph at lines 2348--2349 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::read[]EMBL[]GenomicRegion[]file (file name) [53] Overfull \hbox (7.08008pt too wide) in paragraph at lines 2401--2402 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::show[]ace[]GenomicRegion (gr,seq[]nam e,ofp) Overfull \hbox (3.5338pt too wide) in paragraph at lines 2426--2427 []\OT1/cmtt/m/n/10 Wise2[]show[]pretty[]GenomicRegion (gr,show[]supporting,ofp) Overfull \hbox (59.57962pt too wide) in paragraph at lines 2427--2428 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::show[]pretty[]GenomicRegion (gr,show[ ]supporting,ofp) [54] [55] [56] Overfull \hbox (32.9967pt too wide) in paragraph at lines 2592--2592 [] \OT1/cmtt/m/n/10 b) cooperation with future versions of histogram.c would be possible.[] [57] [58] [59] Overfull \hbox (123.4428pt too wide) in paragraph at lines 2794--2795 []\OT1/cmtt/m/n/10 Wise2[]ExtremeValueSetHistogram (h,mu,lambda,lowbound,highbo und,wonka,ndegrees) Overfull \hbox (67.76958pt too wide) in paragraph at lines 2795--2796 []\OT1/cmtt/m/n/10 &Wise2::Histogram::set[]EVD (h,mu,lambda,lowbound,highbound, wonka,ndegrees) Overfull \hbox (33.66461pt too wide) in paragraph at lines 2797--2798 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->set[]EVD(mu,lambda,lowbound,highbound ,wonka,ndegrees) [60] [61] [62] Overfull \hbox (30.97293pt too wide) in paragraph at lines 2971--2972 []\OT1/cmr/m/n/10 should[]store Type [boolean (*should[]store)(int given[]score ,double in-ter-nal[]score[]level) [63] [64] [65] [66] [67] [68] [69] [70] [71] [72] [73] [74] [75] [76] Overfull \hbox (16.34366pt too wide) in paragraph at lines 3839--3840 []\OT1/cmtt/m/n/10 Wise2[]force[]to[]dna[]Sequence (seq,fraction,number[]of[]co nver) [77] [78] [79] [80] [81] [82] [83] [84] [85] [86] [87] Overfull \hbox (24.01358pt too wide) in paragraph at lines 4508--4515 \OT1/cmr/m/n/10 have any se-quence in it. When se-quence is asked for by get[]P rotein[]from[]Translation() [88] [89] Overfull \hbox (62.7533pt too wide) in paragraph at lines 4609--4610 []\OT1/cmtt/m/n/10 Wise2[]make[]align[]dnaalign (one,two,mat,se,qgap,qext,tgap, text,dpri) Overfull \hbox (40.0498pt too wide) in paragraph at lines 4610--4611 []\OT1/cmtt/m/n/10 &Wise2::make[]align[]dnaalign (one,two,mat,se,qgap,qext,tgap ,text,dpri) [90] Overfull \hbox (335.96082pt too wide) in paragraph at lines 4671--4672 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]TSM[]estwise (tdb,cdb,cp,cm,rmd,use[]sy n,alg,bits[]cutoff,allN,flat[]insert,report[]level,die[]on[]error,dbsi) Overfull \hbox (313.25732pt too wide) in paragraph at lines 4672--4673 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]TSM[]estwise (tdb,cdb,cp,cm,rmd,use[]s yn,alg,bits[]cutoff,allN,flat[]insert,report[]level,die[]on[]error,dbsi) [91] Overfull \hbox (329.87091pt too wide) in paragraph at lines 4698--4699 []\OT1/cmtt/m/n/10 Wise2[]AlnBlock[]from[]Protein[]estwise[]wrap (pro,cdna,cp,c m,ct,comp,gap,ext,is[]global,rmd,alg,rm,use[]syn,allN,dpri,palpoi) Overfull \hbox (270.41774pt too wide) in paragraph at lines 4699--4700 []\OT1/cmtt/m/n/10 &Wise2::AlnBlock[]from[]Protein[]estwise[]wrap (pro,cdna,cp, cm,ct,comp,gap,ext,is[]global,rmd,alg,rm,use[]syn,allN,dpri) [92] Overfull \hbox (265.40146pt too wide) in paragraph at lines 4732--4733 []\OT1/cmtt/m/n/10 Wise2[]AlnBlock[]from[]TSM[]estwise[]wrap (tsm,cdna,cp,cm,ct ,rmd,alg,use[]syn,force[]flat[]insert,allN,dpri,palpoi) Overfull \hbox (205.94829pt too wide) in paragraph at lines 4733--4734 []\OT1/cmtt/m/n/10 &Wise2::AlnBlock[]from[]TSM[]estwise[]wrap (tsm,cdna,cp,cm,c t,rmd,alg,use[]syn,force[]flat[]insert,allN,dpri) [93] Overfull \hbox (47.00343pt too wide) in paragraph at lines 4780--4781 []\OT1/cmtt/m/n/10 Wise2[]protein2genomic[]ascii[]display (alb,p,gen,ct,name,ma in,ofp) Overfull \hbox (24.29994pt too wide) in paragraph at lines 4781--4782 []\OT1/cmtt/m/n/10 &Wise2::protein2genomic[]ascii[]display (alb,p,gen,ct,name,m ain,ofp) [94] Overfull \hbox (188.7522pt too wide) in paragraph at lines 4801--4802 []\OT1/cmtt/m/n/10 Wise2[]protcdna[]ascii[]display (alb,protsequence,protname,p rotoff,cdna,ct,name,main,mult,ofp) Overfull \hbox (166.0487pt too wide) in paragraph at lines 4802--4803 []\OT1/cmtt/m/n/10 &Wise2::protcdna[]ascii[]display (alb,protsequence,protname, protoff,cdna,ct,name,main,mult,ofp) [95] Overfull \hbox (1.40793pt too wide) in paragraph at lines 4893--4894 []\OT1/cmr/m/n/10 transition[GENEFREQUENCY21[]TRANSITION[]LEN] Type [dou-ble : Scalar] [96] [97] Overfull \hbox (71.7832pt too wide) in paragraph at lines 5014--5015 []\OT1/cmtt/m/n/10 Wise2[]MatchSummarySet[]from[]AlnBlock[]estwise (alb,qname,o ffset,target) Overfull \hbox (1.83012pt too wide) in paragraph at lines 5015--5016 []\OT1/cmtt/m/n/10 &Wise2::MatchSummarySet::MatchSummarySet[]from[]AlnBlock[]es twise Overfull \hbox (62.22433pt too wide) in paragraph at lines 5017--5018 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->MatchSummarySet[]from[]AlnBlock[]estw ise(qname,offset,target) [98] Overfull \hbox (82.28311pt too wide) in paragraph at lines 5040--5041 []\OT1/cmtt/m/n/10 Wise2[]MatchSummarySet[]from[]AlnBlock[]genewise (alb,qname, protoff,target) Overfull \hbox (7.08008pt too wide) in paragraph at lines 5041--5042 []\OT1/cmtt/m/n/10 &Wise2::MatchSummarySet::MatchSummarySet[]from[]AlnBlock[]ge newise Overfull \hbox (72.72424pt too wide) in paragraph at lines 5043--5044 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->MatchSummarySet[]from[]AlnBlock[]gene wise(qname,protoff,target) [99] [100] Overfull \hbox (92.78302pt too wide) in paragraph at lines 5174--5175 []\OT1/cmtt/m/n/10 Wise2[]write[]pretty[]str[]align (alb,qname,query,tname,targ et,name,main,ofp) Overfull \hbox (70.07953pt too wide) in paragraph at lines 5175--5176 []\OT1/cmtt/m/n/10 &Wise2::write[]pretty[]str[]align (alb,qname,query,tname,tar get,name,main,ofp) [101] Overfull \hbox (3.5338pt too wide) in paragraph at lines 5217--5218 []\OT1/cmtt/m/n/10 Wise2[]write[]pretty[]Protein[]align (alb,q,t,name,main,ofp) [102] Overfull \hbox (29.5499pt too wide) in paragraph at lines 5290--5291 []\OT1/cmtt/m/n/10 &Wise2::DnaSequenceHitList::read[]MSPcrunch[]DnaSequenceHitL ist (ifp) [103] Overfull \hbox (99.50298pt too wide) in paragraph at lines 5348--5349 []\OT1/cmtt/m/n/10 Wise2[]Align[]strings[]ProteinSmithWaterman (one,two,comp,ga p,ext,dpenv,dpri) Overfull \hbox (76.79948pt too wide) in paragraph at lines 5349--5350 []\OT1/cmtt/m/n/10 &Wise2::Align[]strings[]ProteinSmithWaterman (one,two,comp,g ap,ext,dpenv,dpri) [104] Overfull \hbox (110.00288pt too wide) in paragraph at lines 5373--5374 []\OT1/cmtt/m/n/10 Wise2[]Align[]Sequences[]ProteinSmithWaterman (one,two,comp, gap,ext,dpenv,dpri) Overfull \hbox (87.2994pt too wide) in paragraph at lines 5374--5375 []\OT1/cmtt/m/n/10 &Wise2::Align[]Sequences[]ProteinSmithWaterman (one,two,comp ,gap,ext,dpenv,dpri) Overfull \hbox (7.58401pt too wide) in paragraph at lines 5386--5387 []\OT1/cmr/m/n/10 [OWNER] new AlnBlock struc-ture rep-re-sent-ing the align-men t [AlnBlock [105] Overfull \hbox (68.00325pt too wide) in paragraph at lines 5407--5408 []\OT1/cmtt/m/n/10 Wise2[]Align[]Proteins[]SmithWaterman (one,two,comp,gap,ext, dpenv,dpri) Overfull \hbox (45.29976pt too wide) in paragraph at lines 5408--5409 []\OT1/cmtt/m/n/10 &Wise2::Align[]Proteins[]SmithWaterman (one,two,comp,gap,ext ,dpenv,dpri) Overfull \hbox (5.0038pt too wide) in paragraph at lines 5434--5435 []\OT1/cmtt/m/n/10 Wise2[]Align[]Proteins[]ABC (one,two,comp,a,b,c,dpenv,dpri) [106] Overfull \hbox (47.00343pt too wide) in paragraph at lines 5455--5456 []\OT1/cmtt/m/n/10 Wise2[]Align[]Sequences[]ProteinABC (one,two,comp,a,b,c,dpen v,dpri) Overfull \hbox (24.29994pt too wide) in paragraph at lines 5456--5457 []\OT1/cmtt/m/n/10 &Wise2::Align[]Sequences[]ProteinABC (one,two,comp,a,b,c,dpe nv,dpri) Overfull \hbox (86.01088pt too wide) in paragraph at lines 5471--5474 \OT1/cmr/m/n/10 Align[]Sequences[]ProteinABC this func-tion is anal-o-gous to A lign[]Sequences[]ProteinSmithWaterman Overfull \hbox (240.62169pt too wide) in paragraph at lines 5478--5479 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinSW (querydb,targetdb,comp,gap,ex t,bits[]cutoff,report[]level,die[]on[]error,dbsi) Overfull \hbox (217.9182pt too wide) in paragraph at lines 5479--5480 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinSW (querydb,targetdb,comp,gap,e xt,bits[]cutoff,report[]level,die[]on[]error,dbsi) [107] Overfull \hbox (235.37173pt too wide) in paragraph at lines 5500--5501 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinABC (querydb,targetdb,comp,a,b,c ,bits[]cutoff,report[]level,die[]on[]error,dbsi) Overfull \hbox (212.66824pt too wide) in paragraph at lines 5501--5502 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinABC (querydb,targetdb,comp,a,b, c,bits[]cutoff,report[]level,die[]on[]error,dbsi) [108] Overfull \hbox (359.90063pt too wide) in paragraph at lines 5523--5524 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinBA (querydb,targetdb,comp,bentry ,bexit,bfor[]trans,b[]self[]trans,b3exit,bits[]cutoff,report[]level,dbsi) Overfull \hbox (337.19714pt too wide) in paragraph at lines 5524--5525 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinBA (querydb,targetdb,comp,bentr y,bexit,bfor[]trans,b[]self[]trans,b3exit,bits[]cutoff,report[]level,dbsi) [109] Overfull \hbox (15.42177pt too wide) in paragraph at lines 5587--5588 []\OT1/cmr/m/n/10 reload[]generic Type [Three-State-Model * (*reload[]generic)( ThreeStateDB * tdb,int Overfull \hbox (3.42192pt too wide) in paragraph at lines 5594--5595 []\OT1/cmr/m/n/10 dataentry[]add Type [boolean (*dataen-try[]add)(ThreeStateDB * tdb,DataEntry Overfull \hbox (41.78299pt too wide) in paragraph at lines 5598--5599 []\OT1/cmr/m/n/10 index[]generic Type [Three-State-Model * (*in-dex[]generic)(T hreeStateDB *tdb,DataEntry [110] Overfull \hbox (29.5499pt too wide) in paragraph at lines 5669--5670 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateDB::new[]proteindb[]ThreeStateDB (sdb,comp ,gap,ext) [111] [112] [113] Overfull \hbox (16.10999pt too wide) in paragraph at lines 5802--5803 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::force[]global[]model (tsm,prob[]int o[]model) Overfull \hbox (102.65288pt too wide) in paragraph at lines 5822--5823 []\OT1/cmtt/m/n/10 Wise2[]force[]weighted[]local[]model (tsm,prob[]into[]model, ratio[]start,ratio[]end) Overfull \hbox (169.19861pt too wide) in paragraph at lines 5823--5824 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::force[]weighted[]local[]model (tsm, prob[]into[]model,ratio[]start,ratio[]end) Overfull \hbox (93.09401pt too wide) in paragraph at lines 5825--5826 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->force[]weighted[]local[]model(prob[]i nto[]model,ratio[]start,ratio[]end) Overfull \hbox (49.31339pt too wide) in paragraph at lines 5845--5846 []\OT1/cmtt/m/n/10 Wise2[]ThreeStateModel[]from[]half[]bit[]Sequence (pro,mat,r m,gap,ext) [114] Overfull \hbox (5.61008pt too wide) in paragraph at lines 5846--5847 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::ThreeStateModel[]from[]half[]bit[]S equence Overfull \hbox (39.75452pt too wide) in paragraph at lines 5848--5849 []\TS1/cmtt/m/n/10 $\OT1/cmtt/m/n/10 obj->ThreeStateModel[]from[]half[]bit[]Seq uence(mat,rm,gap,ext) Overfull \hbox (51.38966pt too wide) in paragraph at lines 5872--5873 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::write[]HMMer[]1[]7[]ascii[]ThreeSta teModel (tsm,ofp) [115] [116] (./api.aux) LaTeX Warning: There were undefined references. LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on api.pdf (116 pages, 318716 bytes). Transcript written on api.log. cd docs && pdflatex dynamite.tex This is pdfTeX, Version 3.141592653-2.6-1.40.22 (TeX Live 2022/dev/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./dynamite.tex LaTeX2e <2021-11-15> patch level 1 L3 programming layer <2022-01-21> (/usr/share/texlive/texmf-dist/tex/latex/base/latex209.def Entering LaTeX 2.09 COMPATIBILITY MODE ************************************************************* !!WARNING!! !!WARNING!! !!WARNING!! !!WARNING!! This mode attempts to provide an emulation of the LaTeX 2.09 author environment so that OLD documents can be successfully processed. It should NOT be used for NEW documents! New documents should use Standard LaTeX conventions and start with the \documentclass command. Compatibility mode is UNLIKELY TO WORK with LaTeX 2.09 style files that change any internal macros, especially not with those that change the FONT SELECTION or OUTPUT ROUTINES. Therefore such style files MUST BE UPDATED to use Current Standard LaTeX: LaTeX2e. If you suspect that you may be using such a style file, which is probably very, very old by now, then you should attempt to get it updated by sending a copy of this error message to the author of that file. ************************************************************* (/usr/share/texlive/texmf-dist/tex/latex/base/tracefnt.sty) (/usr/share/texlive/texmf-dist/tex/latex/base/latexsym.sty)) (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2021/10/04 v1.4n Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (/usr/share/texlive/texmf-dist/tex/latex/l3backend/l3backend-pdftex.def) No file dynamite.aux. (/usr/share/texlive/texmf-dist/tex/latex/base/ulasy.fd) [1{/var/lib/texmf/fonts /map/pdftex/updmap/pdftex.map}] No file dynamite.toc. [2] [3] LaTeX Warning: Reference `own_objects' on page 4 undefined on input line 77. [4] [5] [6] Overfull \hbox (4.11092pt too wide) in paragraph at lines 253--257 \OT1/cmr/m/n/10 tri-bu-tion from 'ftp://ftp.sanger.ac.uk/pub/birney/dynamite/dy n.x.tar.Z' (where [7] [8] [9] [10] Overfull \hbox (48.74657pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fprintf(ofp,"\npsw seq1 seq2\nBoth sequences in fasta format\n"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * -g for gap value (an int) - rely on commandline error p rocessing[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * -e for ext value (an int) - rely on commandline error p rocessing[] [11] Overfull \hbox (269.24464pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 if( strip_out_boolean_argument(&argc,argv,"h") == TRUE || strip_out_boolean_argument(&argc,argv,"-help") == TRUE) {[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 warn("Must have two arguments for sequence 1 and sequenc e 2 %d",argc);[] [12] Overfull \hbox (22.4968pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * or WISEPERSONALDIR if it is not present in the current directory.[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * If the sequences are small enough then it should use ex plicit memory.[] [13] Overfull \hbox (59.24648pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext,NULL);[] Overfull \hbox (80.24629pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] [14] Overfull \hbox (48.74657pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 * If the sequences are small enough then it should use ex plicit memory.[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext,NULL);[] [15] Overfull \hbox (80.24629pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 639--639 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext);[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 654--654 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] [16] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 EPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMR DPTTKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 EPE LRK+F+GGL+ TTD+ +R + Q+G +TD +VMR DP TKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMR DPNTKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKN RSESNVSTKR[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 GFVT++ EVDAAM RPH +DG+ V+PKRAV R+D R ++++ K+[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN GFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ RPGAHLTVKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 LYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKP RGFGFVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 ++V G++ED E L +YF +YG + EI+ D+ + K RGF FVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKK RGFAFVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 HDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMNRD RETRGGRSRD[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 HDSVD+ V+QK H VNGH C+VRK LSK EM+ A ++ GRS[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN HDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS---- -SSQRGRSGS[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GQRGGYNGGG-GGGGGWGGPAQRGGPGAYGGP-GGGGQG GYGGDYGG--[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 G GG GGG GG +G G G +GG GGGG G G G Y G[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN GNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYG GSGDGYNGFG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GWGQQGGGGQGGWGGPQQQQGGG-GWGQQGGGGQGGWGG PQQQQQGGWG[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 G GGGG G GG + GG G+G QG G GG G GG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN NDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSG-YGGSGS YDSYNNGGGR[] [17] [18] Overfull \hbox (48.88945pt too wide) in paragraph at lines 793--795 []\OT1/cmr/m/n/10 The align-ment is the set of (i,j,) triples, where sta te is one of (Match,Insert,Delete) [19] [20] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] [21] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] [22] Overfull \hbox (32.64503pt too wide) in paragraph at lines 1015--1019 \OT1/cmr/m/n/10 and GE-NOMIC[]INTRON. No-tice how the source lines to and from GE-NOMIC[]INSERT Overfull \hbox (38.24666pt too wide) in paragraph at lines 1116--1116 []\OT1/cmtt/m/n/10 #define DnaMatrix_Score(dnamat,base1,base2) (dnamat->score[b ase1][base2])[] [23] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1116--1116 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,i),GENOMIC_BASE(tar get,j))"[] [24] [25] Overfull \hbox (122.24593pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fprintf(ofp,"\nest2gen est-seq genomic-seq\nBoth sequences in fasta format\n"[] [26] Overfull \hbox (269.24464pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 if( strip_out_boolean_argument(&argc,argv,"h") == TRUE || strip_out_boolean_argument(&argc,argv,"-help") == TRUE) {[] [27] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 warn("Must have two arguments for sequence 1 and sequenc e 2 %d",argc);[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * To do this we need a cdna ComplexSequenceEvalSet and a genomic one[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * Really our genomic model should be alot more complex. T he 'default' one[] Overfull \hbox (38.24666pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * has 0 at GT----AG for 5' and 3' splice sites, and NEGI (= -infinity)[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * We could build up something much better, using complexc onsensi and[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * other machinery, but not for now . See the genewi se code if you[] [28] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * cDNA2Gen has alot more parameter space than the paramet ers to this[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * program. Firstly we are treating errors similarly on ea ch side of the[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * Secondly there is a rather complex interaction between the gap/extension[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * of what is thought to be sequencing error and the intro ns. Here we have[] Overfull \hbox (64.49643pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * one more parameter, and intron open penalty, which can be set, to prevent[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * One good way to parameterise all this would be to have a probabilistic[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * model of the processes, derive probabilities and then m ap them to ints[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * (probability.h has got these mappings, such as Probabil ity2Score).[] Overfull \hbox (101.24611pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_cDNA2Gen(query_cs,target_cs,dm,ga p,-ext,-gap,-ext,0,NULL);[] Overfull \hbox (80.24629pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] [29] Overfull \hbox (74.99634pt too wide) in paragraph at lines 1342--1342 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_cDNA2Gen(query_cs,target_cs,dm,ga p,-ext,-gap,-ext,0);[] [30] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * To do this we need a cdna ComplexSequenceEvalSet and a genomic one[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * Really our genomic model should be alot more complex. T he 'default' one[] Overfull \hbox (38.24666pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * has 0 at GT----AG for 5' and 3' splice sites, and NEGI (= -infinity)[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * We could build up something much better, using complexc onsensi and[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * other machinery, but not for now . See the genewi se code if you[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 1 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GATGGT-TAT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GAT T T T[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2132 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GAT--TAT-T[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 49 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2178 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] [31] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 98 CAGTGGCAAGAAAAGGGGCTTTGCCT-TAGTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 CAGTGGCAAGAAAAGGGGCTTTGCCT T GTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2227 CAGTGGCAAGAAAAGGGGCTTTGCCTTT-GTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 146 CTCCGTGGATAAGATTGTCA TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 CTCCGTGGATAAGATTGTCA TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2275 CTCCGTGGATAAGATTGTCA<-2295:2387->TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 182 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2404 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 231 ATGGCTAGTGCTTCATCCAGCCAAAGAG GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 ATGGCTAGTGCTTCATCCAGCCAAAGAG GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2453 ATGGCTAGTGCTTCATCCAGCCAAAGAG<-2481:2566 ->GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 267 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2575 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2624 ACAACTTCGGTCGTGGAGGAAACTTCAGTGGTCGTG<-2 660:2793->[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 352 GTNG-CTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GT G CTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2794 GT-GGCTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 400 ATGGCTATAATGGATTTGGCAATGATG GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 ATGGCTATAATGGATTTGGCAATGATG GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2842 ATGGCTATAATGGATTTGGCAATGATG<-2869:3805- >GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 436 TTGGAGGTGGTGGAAGCTACAATGATTTTGGG--tttat gcA-CAATCA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TTGGAGGTGGTGGAAGCTACAATGATTTTGGG ++ + +A CAATCA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3815 TTGGAGGTGGTGGAAGCTACAATGATTTTGGGAATT-A- -CAACAATCA[] [32] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 482 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3861 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 531 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3910 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 580 AAG GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 AAG GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3959 AAG<-3962:4251->GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] [33] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1572--1572 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1572--1572 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [34] [35] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1600--1600 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 1634--1634 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_MyProteinSW(seqone,seqtwo,mat,-12, -2,NULL);[] Overfull \hbox (127.49588pt too wide) in paragraph at lines 1634--1634 [] \OT1/cmtt/m/n/10 fprintf(stdout,"%d,%d are matched with score %d\n",uni t->i+1,unit->j+1,unit->score);[] [36] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1727--1727 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1727--1727 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [37] [38] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1849--1849 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1849--1849 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [39] Overfull \hbox (258.74474pt too wide) in paragraph at lines 1849--1849 [] \OT1/cmtt/m/n/10 calc="ALPHA_SEQ_SCORE(query,i) + ALPHA_SEQ_SCORE(target,j) + mat_alpha.comp[SEQ_POS(query,i)][SEQ_POS(target,j)]"[] [40] [41] Overfull \hbox (20.54509pt too wide) in paragraph at lines 1911--1912 []\OT1/cmr/m/n/10 The macro Dna-Ma-trix[]Score which is de-fined at the top of the cdna2genomic.dy Overfull \hbox (17.24684pt too wide) in paragraph at lines 1928--1928 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,i),GENOMIC_CODON(ta rget,j))"[] [42] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1944--1944 [] \OT1/cmtt/m/n/10 Mis-type in argument 3 of DNA\_MAT\_SCORE: wanted [b ase] got [codon][] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1955--1955 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,j),GENOMIC_BASE(tar get,j))"[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 1967--1967 [] \OT1/cmtt/m/n/10 For function CDNA\_BASE, you have arguments j and qu ery, which do not[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1967--1967 []\OT1/cmtt/m/n/10 expect to paired directly in a function. This is just a warn ing that[] [43] Overfull \hbox (17.24684pt too wide) in paragraph at lines 2014--2014 [] \OT1/cmtt/m/n/10 throw_warning("Letter %c does not exist in comparison matr ix",one);[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 2014--2014 [] \OT1/cmtt/m/n/10 throw_warning("Letter %c does not exist in comparison matr ix",two);[] [44] [45] Overfull \hbox (74.99634pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fprintf(stdout,"dbsearch [options] \n");[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /** add more options here sometime, eg comp matrix and gap penalty*/[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /** print out dbsearch options. We don't know here what im plementations are[] Overfull \hbox (74.99634pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 either possible or how they are specified. Of course, there is the problem[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 that we could clash our options with the dbsearchimpl options, but that[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 is not too likely, and this makes this program future proof wrt to new[] [46] Overfull \hbox (43.49661pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 * care about which implementation is used, and does not k now either (!)[] [47] Overfull \hbox (106.49606pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /* 10 means a score cutoff of 10, -1 means don't report on stderr search progress */[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 if( search_ProteinSW(dbsi,out,querydb,prodb,mat,-12,-2) != SEARCH_OK )[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fatal("Some sort of error in the database search. Dieing ungracefully");[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (174.74547pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fprintf(stdout,"Comparison to %s was %d score\n",out-> ds[i]->target->name,out->ds[i]->score);[] Overfull \hbox (1.49698pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 temp = get_Protein_from_ProteinDB(prodb,out->ds[i]->ta rget);[] [48] Overfull \hbox (69.74638pt too wide) in paragraph at lines 2255--2255 []\OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s",te mp->baseseq->name);[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs, mat,-12,-2,NULL);[] Overfull \hbox (95.99615pt too wide) in paragraph at lines 2255--2255 []\OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query->na me,temp->baseseq->name);[] Overfull \hbox (6.74693pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 write_pretty_seq_align(alb,query,temp->baseseq,15,50,s tdout);[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 2263--2263 [] \OT1/cmtt/m/n/10 if( search_ProteinSW(dbsi,out,querydb,prodb,mat,-12,-2) != SEARCH_OK )[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2263--2263 [] \OT1/cmtt/m/n/10 fatal("Some sort of error in the database search. Dieing ungracefully");[] [49] Overfull \hbox (1.49698pt too wide) in paragraph at lines 2292--2292 [] \OT1/cmtt/m/n/10 temp = get_Protein_from_ProteinDB(prodb,out->ds[i]->ta rget);[] [50] [51] [52] [53] [54] Overfull \hbox (1.32472pt too wide) in paragraph at lines 2528--2534 \OT1/cmr/m/n/10 de-scribed by a "state...endstate" multi-line block. Within eac h "state...endstate" [55] [56] [57] [58] [59] Overfull \hbox (1.75064pt too wide) in paragraph at lines 2772--2776 \OT1/cmr/m/n/10 Dy-na-mite file: for ex-am-ple the fol-low-ing er-ror was made by mistyp-ing ``MATCH'' Overfull \hbox (59.24648pt too wide) in paragraph at lines 2792--2792 [] \OT1/cmtt/m/n/10 In matrix ProteinSW - State MATCH asks for source MA TCH2 but there is[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 2792--2792 [] \OT1/cmtt/m/n/10 Failing simple cross-checks, aborting before calc-li ne parsing[] [60] [61] [62] (./dynamite.aux) LaTeX Warning: There were undefined references. LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on dynamite.pdf (62 pages, 221200 bytes). Transcript written on dynamite.log. cd docs && pdflatex dynamite.tex This is pdfTeX, Version 3.141592653-2.6-1.40.22 (TeX Live 2022/dev/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./dynamite.tex LaTeX2e <2021-11-15> patch level 1 L3 programming layer <2022-01-21> (/usr/share/texlive/texmf-dist/tex/latex/base/latex209.def Entering LaTeX 2.09 COMPATIBILITY MODE ************************************************************* !!WARNING!! !!WARNING!! !!WARNING!! !!WARNING!! This mode attempts to provide an emulation of the LaTeX 2.09 author environment so that OLD documents can be successfully processed. It should NOT be used for NEW documents! New documents should use Standard LaTeX conventions and start with the \documentclass command. Compatibility mode is UNLIKELY TO WORK with LaTeX 2.09 style files that change any internal macros, especially not with those that change the FONT SELECTION or OUTPUT ROUTINES. Therefore such style files MUST BE UPDATED to use Current Standard LaTeX: LaTeX2e. If you suspect that you may be using such a style file, which is probably very, very old by now, then you should attempt to get it updated by sending a copy of this error message to the author of that file. ************************************************************* (/usr/share/texlive/texmf-dist/tex/latex/base/tracefnt.sty) (/usr/share/texlive/texmf-dist/tex/latex/base/latexsym.sty)) (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2021/10/04 v1.4n Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (/usr/share/texlive/texmf-dist/tex/latex/l3backend/l3backend-pdftex.def) (./dynamite.aux) (/usr/share/texlive/texmf-dist/tex/latex/base/ulasy.fd) [1{/var/lib/texmf/fonts/map/pdftex/updmap/pdftex.map}] (./dynamite.toc [2] Overfull \hbox (8.02837pt too wide) in paragraph at lines 50--50 [][] []\OT1/cmr/m/n/10 [Dynamite Level] Did not un-der-stand line [ source MAT CH]. ) [3] [4] [5] [6] [7] [8] Overfull \hbox (4.11092pt too wide) in paragraph at lines 253--257 \OT1/cmr/m/n/10 tri-bu-tion from 'ftp://ftp.sanger.ac.uk/pub/birney/dynamite/dy n.x.tar.Z' (where [9] [10] [11] [12] Overfull \hbox (48.74657pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fprintf(ofp,"\npsw seq1 seq2\nBoth sequences in fasta format\n"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * -g for gap value (an int) - rely on commandline error p rocessing[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * -e for ext value (an int) - rely on commandline error p rocessing[] [13] Overfull \hbox (269.24464pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 if( strip_out_boolean_argument(&argc,argv,"h") == TRUE || strip_out_boolean_argument(&argc,argv,"-help") == TRUE) {[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 warn("Must have two arguments for sequence 1 and sequenc e 2 %d",argc);[] [14] Overfull \hbox (22.4968pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * or WISEPERSONALDIR if it is not present in the current directory.[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * If the sequences are small enough then it should use ex plicit memory.[] [15] Overfull \hbox (59.24648pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext,NULL);[] Overfull \hbox (80.24629pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] [16] Overfull \hbox (48.74657pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 * If the sequences are small enough then it should use ex plicit memory.[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext,NULL);[] [17] Overfull \hbox (80.24629pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 639--639 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext);[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 654--654 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] [18] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 EPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMR DPTTKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 EPE LRK+F+GGL+ TTD+ +R + Q+G +TD +VMR DP TKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMR DPNTKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKN RSESNVSTKR[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 GFVT++ EVDAAM RPH +DG+ V+PKRAV R+D R ++++ K+[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN GFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ RPGAHLTVKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 LYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKP RGFGFVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 ++V G++ED E L +YF +YG + EI+ D+ + K RGF FVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKK RGFAFVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 HDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMNRD RETRGGRSRD[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 HDSVD+ V+QK H VNGH C+VRK LSK EM+ A ++ GRS[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN HDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS---- -SSQRGRSGS[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GQRGGYNGGG-GGGGGWGGPAQRGGPGAYGGP-GGGGQG GYGGDYGG--[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 G GG GGG GG +G G G +GG GGGG G G G Y G[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN GNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYG GSGDGYNGFG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GWGQQGGGGQGGWGGPQQQQGGG-GWGQQGGGGQGGWGG PQQQQQGGWG[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 G GGGG G GG + GG G+G QG G GG G GG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN NDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSG-YGGSGS YDSYNNGGGR[] [19] [20] Overfull \hbox (48.88945pt too wide) in paragraph at lines 793--795 []\OT1/cmr/m/n/10 The align-ment is the set of (i,j,) triples, where sta te is one of (Match,Insert,Delete) [21] [22] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] [23] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] [24] Overfull \hbox (32.64503pt too wide) in paragraph at lines 1015--1019 \OT1/cmr/m/n/10 and GE-NOMIC[]INTRON. No-tice how the source lines to and from GE-NOMIC[]INSERT Overfull \hbox (38.24666pt too wide) in paragraph at lines 1116--1116 []\OT1/cmtt/m/n/10 #define DnaMatrix_Score(dnamat,base1,base2) (dnamat->score[b ase1][base2])[] [25] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1116--1116 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,i),GENOMIC_BASE(tar get,j))"[] [26] [27] Overfull \hbox (122.24593pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fprintf(ofp,"\nest2gen est-seq genomic-seq\nBoth sequences in fasta format\n"[] [28] Overfull \hbox (269.24464pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 if( strip_out_boolean_argument(&argc,argv,"h") == TRUE || strip_out_boolean_argument(&argc,argv,"-help") == TRUE) {[] [29] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 warn("Must have two arguments for sequence 1 and sequenc e 2 %d",argc);[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * To do this we need a cdna ComplexSequenceEvalSet and a genomic one[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * Really our genomic model should be alot more complex. T he 'default' one[] Overfull \hbox (38.24666pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * has 0 at GT----AG for 5' and 3' splice sites, and NEGI (= -infinity)[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * We could build up something much better, using complexc onsensi and[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * other machinery, but not for now . See the genewi se code if you[] [30] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * cDNA2Gen has alot more parameter space than the paramet ers to this[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * program. Firstly we are treating errors similarly on ea ch side of the[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * Secondly there is a rather complex interaction between the gap/extension[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * of what is thought to be sequencing error and the intro ns. Here we have[] Overfull \hbox (64.49643pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * one more parameter, and intron open penalty, which can be set, to prevent[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * One good way to parameterise all this would be to have a probabilistic[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * model of the processes, derive probabilities and then m ap them to ints[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * (probability.h has got these mappings, such as Probabil ity2Score).[] Overfull \hbox (101.24611pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_cDNA2Gen(query_cs,target_cs,dm,ga p,-ext,-gap,-ext,0,NULL);[] Overfull \hbox (80.24629pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] [31] Overfull \hbox (74.99634pt too wide) in paragraph at lines 1342--1342 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_cDNA2Gen(query_cs,target_cs,dm,ga p,-ext,-gap,-ext,0);[] [32] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * To do this we need a cdna ComplexSequenceEvalSet and a genomic one[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * Really our genomic model should be alot more complex. T he 'default' one[] Overfull \hbox (38.24666pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * has 0 at GT----AG for 5' and 3' splice sites, and NEGI (= -infinity)[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * We could build up something much better, using complexc onsensi and[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * other machinery, but not for now . See the genewi se code if you[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 1 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GATGGT-TAT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GAT T T T[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2132 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GAT--TAT-T[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 49 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2178 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] [33] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 98 CAGTGGCAAGAAAAGGGGCTTTGCCT-TAGTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 CAGTGGCAAGAAAAGGGGCTTTGCCT T GTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2227 CAGTGGCAAGAAAAGGGGCTTTGCCTTT-GTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 146 CTCCGTGGATAAGATTGTCA TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 CTCCGTGGATAAGATTGTCA TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2275 CTCCGTGGATAAGATTGTCA<-2295:2387->TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 182 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2404 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 231 ATGGCTAGTGCTTCATCCAGCCAAAGAG GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 ATGGCTAGTGCTTCATCCAGCCAAAGAG GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2453 ATGGCTAGTGCTTCATCCAGCCAAAGAG<-2481:2566 ->GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 267 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2575 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2624 ACAACTTCGGTCGTGGAGGAAACTTCAGTGGTCGTG<-2 660:2793->[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 352 GTNG-CTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GT G CTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2794 GT-GGCTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 400 ATGGCTATAATGGATTTGGCAATGATG GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 ATGGCTATAATGGATTTGGCAATGATG GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2842 ATGGCTATAATGGATTTGGCAATGATG<-2869:3805- >GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 436 TTGGAGGTGGTGGAAGCTACAATGATTTTGGG--tttat gcA-CAATCA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TTGGAGGTGGTGGAAGCTACAATGATTTTGGG ++ + +A CAATCA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3815 TTGGAGGTGGTGGAAGCTACAATGATTTTGGGAATT-A- -CAACAATCA[] [34] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 482 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3861 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 531 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3910 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 580 AAG GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 AAG GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3959 AAG<-3962:4251->GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] [35] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1572--1572 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1572--1572 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [36] [37] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1600--1600 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 1634--1634 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_MyProteinSW(seqone,seqtwo,mat,-12, -2,NULL);[] Overfull \hbox (127.49588pt too wide) in paragraph at lines 1634--1634 [] \OT1/cmtt/m/n/10 fprintf(stdout,"%d,%d are matched with score %d\n",uni t->i+1,unit->j+1,unit->score);[] [38] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1727--1727 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1727--1727 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [39] [40] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1849--1849 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1849--1849 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [41] Overfull \hbox (258.74474pt too wide) in paragraph at lines 1849--1849 [] \OT1/cmtt/m/n/10 calc="ALPHA_SEQ_SCORE(query,i) + ALPHA_SEQ_SCORE(target,j) + mat_alpha.comp[SEQ_POS(query,i)][SEQ_POS(target,j)]"[] [42] [43] Overfull \hbox (20.54509pt too wide) in paragraph at lines 1911--1912 []\OT1/cmr/m/n/10 The macro Dna-Ma-trix[]Score which is de-fined at the top of the cdna2genomic.dy Overfull \hbox (17.24684pt too wide) in paragraph at lines 1928--1928 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,i),GENOMIC_CODON(ta rget,j))"[] [44] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1944--1944 [] \OT1/cmtt/m/n/10 Mis-type in argument 3 of DNA\_MAT\_SCORE: wanted [b ase] got [codon][] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1955--1955 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,j),GENOMIC_BASE(tar get,j))"[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 1967--1967 [] \OT1/cmtt/m/n/10 For function CDNA\_BASE, you have arguments j and qu ery, which do not[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1967--1967 []\OT1/cmtt/m/n/10 expect to paired directly in a function. This is just a warn ing that[] [45] Overfull \hbox (17.24684pt too wide) in paragraph at lines 2014--2014 [] \OT1/cmtt/m/n/10 throw_warning("Letter %c does not exist in comparison matr ix",one);[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 2014--2014 [] \OT1/cmtt/m/n/10 throw_warning("Letter %c does not exist in comparison matr ix",two);[] [46] [47] Overfull \hbox (74.99634pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fprintf(stdout,"dbsearch [options] \n");[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /** add more options here sometime, eg comp matrix and gap penalty*/[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /** print out dbsearch options. We don't know here what im plementations are[] Overfull \hbox (74.99634pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 either possible or how they are specified. Of course, there is the problem[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 that we could clash our options with the dbsearchimpl options, but that[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 is not too likely, and this makes this program future proof wrt to new[] [48] Overfull \hbox (43.49661pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 * care about which implementation is used, and does not k now either (!)[] [49] Overfull \hbox (106.49606pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /* 10 means a score cutoff of 10, -1 means don't report on stderr search progress */[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 if( search_ProteinSW(dbsi,out,querydb,prodb,mat,-12,-2) != SEARCH_OK )[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fatal("Some sort of error in the database search. Dieing ungracefully");[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (174.74547pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fprintf(stdout,"Comparison to %s was %d score\n",out-> ds[i]->target->name,out->ds[i]->score);[] Overfull \hbox (1.49698pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 temp = get_Protein_from_ProteinDB(prodb,out->ds[i]->ta rget);[] [50] Overfull \hbox (69.74638pt too wide) in paragraph at lines 2255--2255 []\OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s",te mp->baseseq->name);[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs, mat,-12,-2,NULL);[] Overfull \hbox (95.99615pt too wide) in paragraph at lines 2255--2255 []\OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query->na me,temp->baseseq->name);[] Overfull \hbox (6.74693pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 write_pretty_seq_align(alb,query,temp->baseseq,15,50,s tdout);[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 2263--2263 [] \OT1/cmtt/m/n/10 if( search_ProteinSW(dbsi,out,querydb,prodb,mat,-12,-2) != SEARCH_OK )[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2263--2263 [] \OT1/cmtt/m/n/10 fatal("Some sort of error in the database search. Dieing ungracefully");[] [51] Overfull \hbox (1.49698pt too wide) in paragraph at lines 2292--2292 [] \OT1/cmtt/m/n/10 temp = get_Protein_from_ProteinDB(prodb,out->ds[i]->ta rget);[] [52] [53] [54] [55] [56] Overfull \hbox (1.32472pt too wide) in paragraph at lines 2528--2534 \OT1/cmr/m/n/10 de-scribed by a "state...endstate" multi-line block. Within eac h "state...endstate" [57] [58] [59] [60] [61] Overfull \hbox (1.75064pt too wide) in paragraph at lines 2772--2776 \OT1/cmr/m/n/10 Dy-na-mite file: for ex-am-ple the fol-low-ing er-ror was made by mistyp-ing ``MATCH'' Overfull \hbox (59.24648pt too wide) in paragraph at lines 2792--2792 [] \OT1/cmtt/m/n/10 In matrix ProteinSW - State MATCH asks for source MA TCH2 but there is[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 2792--2792 [] \OT1/cmtt/m/n/10 Failing simple cross-checks, aborting before calc-li ne parsing[] [62] [63] [64] (./dynamite.aux) LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on dynamite.pdf (64 pages, 224767 bytes). Transcript written on dynamite.log. cd docs && pdflatex wise2.tex This is pdfTeX, Version 3.141592653-2.6-1.40.22 (TeX Live 2022/dev/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./wise2.tex LaTeX2e <2021-11-15> patch level 1 L3 programming layer <2022-01-21> (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2021/10/04 v1.4n Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (/usr/share/texlive/texmf-dist/tex/latex/graphics/graphicx.sty (/usr/share/texlive/texmf-dist/tex/latex/graphics/keyval.sty) (/usr/share/texlive/texmf-dist/tex/latex/graphics/graphics.sty (/usr/share/texlive/texmf-dist/tex/latex/graphics/trig.sty) (/usr/share/texlive/texmf-dist/tex/latex/graphics-cfg/graphics.cfg) (/usr/share/texlive/texmf-dist/tex/latex/graphics-def/pdftex.def))) (/usr/share/texlive/texmf-dist/tex/latex/l3backend/l3backend-pdftex.def) No file wise2.aux. (/usr/share/texlive/texmf-dist/tex/context/base/mkii/supp-pdf.mkii [Loading MPS to PDF converter (version 2006.09.02).] ) (/usr/share/texlive/texmf-dist/tex/latex/epstopdf-pkg/epstopdf-base.sty (/usr/share/texlive/texmf-dist/tex/latex/latexconfig/epstopdf-sys.cfg)) [1{/var/lib/texmf/fonts/map/pdftex/updmap/pdftex.map}] No file wise2.toc. [2] [3] [4] LaTeX Warning: Reference `genewise_large' on page 5 undefined on input line 110 . LaTeX Warning: Reference `estwise_large' on page 5 undefined on input line 113. Overfull \hbox (11.99689pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 This program is freely distributed under a GPL. See source d irectory[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 Copyright (c) GRL limited: portions of the code are from sep arate copyright[] [5] Overfull \hbox (32.9967pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 Warning: The bits scores is not probablistically correct for single seqs[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 88 AQKSRPHKIDGRVVEPKRAVPRQ DID[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 A +RPHK+DGRVVEPKRAV R+ D[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 AMNARPHKVDGRVVEPKRAVSRE DSQ[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 1867 gaagaccagggagggcaaggtagGTGAGTG Intron 2 TAGgtc[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 ctacgcaataggttacagctcga<0-----[1936 : 2 083]-0>aca[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 tgtagacggtaatgaagatccaa tta[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 114 SPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDIN IVIDKETGKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 P A TVKK+FVG +K+D +E +RDYF+ +G I I I+ D+ +GKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIE IMTDRGSGKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 2093 acggctagaaatgggaaggaggcccagttgctgaaggag aaagcgagaa[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 gcgcatctaatttggtaaacaaaatgaataaagatatta ttcaggggaa[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 aatccatgagatttctaactaatcaatttagtaatagta cgtcactcga[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 163 RGFAFVEFDDYDPVDKVV QKQHQ[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RGFAFV FDD+D VDK+V QK H[] [6] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RGFAFVTFDDHDSVDKIV L:I[att] QKYHT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 2240 agtgtgatggcgtggaagAGTAAGTA Intron 3 TAGTTcatca[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 ggtcttctaaaactaatt <1-----[2295 : 2387] -1> aaaac[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 gctctactcctccgtgtc gactt[] Overfull \hbox (6.74693pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 tagaagatgactcaaatcgcccgag <1-----[2481 : 2793][] [7] [8] LaTeX Warning: Reference `sec:start_end' on page 9 undefined on input line 297. [9] LaTeX Warning: Reference `half_and_blast' on page 10 undefined on input line 34 6. [10] [11] LaTeX Warning: Reference `genewise_large' on page 12 undefined on input line 45 5. LaTeX Warning: Reference `estwise_large' on page 12 undefined on input line 455 . LaTeX Warning: Reference `compile_pthread' on page 12 undefined on input line 4 66. LaTeX Warning: Reference `half_and_blast' on page 12 undefined on input line 47 3. [12] LaTeX Warning: Reference `half_and_blast' on page 13 undefined on input line 51 3. [13] [14] LaTeX Warning: Reference `running_pthread' on page 15 undefined on input line 6 13. [15] [16] [17] LaTeX Warning: Reference `Figure:genewise21' on page 18 undefined on input line 708. [18] [19] [20] LaTeX Warning: Reference `Figure:genewise623' on page 21 undefined on input lin e 900. [21] Overfull \hbox (2.03789pt too wide) in paragraph at lines 965--968 []\OT1/cmr/m/n/10 Algorithms are named in two parts, \OT1/cmr/m/it/10 descripti ve-word state-number:transition- [22] [23] [24] [25] Overfull \hbox (68.08423pt too wide) in paragraph at lines 1108--1109 []\OT1/cmr/m/n/10 The half-wise pro-tein database, found at ftp://ftp.sanger.ac .uk/pub/birney/wise2/halfwise [26] LaTeX Warning: Reference `sec:commonmode' on page 27 undefined on input line 11 81. [27] LaTeX Warning: Reference `sec:start_end' on page 28 undefined on input line 121 0. [28] Overfull \hbox (42.24687pt too wide) in paragraph at lines 1268--1268 []\OT1/cmtt/m/n/10 pexon [] Overfull \hbox (42.24687pt too wide) in paragraph at lines 1268--1268 []\OT1/cmtt/m/n/10 pexon [] [29] LaTeX Warning: Reference `sec:alg' on page 30 undefined on input line 1276. Overfull \hbox (36.99692pt too wide) in paragraph at lines 1312--1312 []\OT1/cmtt/m/n/10 Bits Query start end Target start end idel s introns[] Overfull \hbox (5.4972pt too wide) in paragraph at lines 1312--1312 []\OT1/cmtt/m/n/10 230.57 roa1_drome 26 347 HSHNRNPA 1386 3963 0 6[] [30] [31] LaTeX Warning: Reference `sec:start_end' on page 32 undefined on input line 137 7. [32] [33] [34] LaTeX Warning: Reference `sec:start_end' on page 35 undefined on input line 146 9. [35] [36] LaTeX Warning: Reference `compile_pthread' on page 37 undefined on input line 1 561. [37] [38] [39] [40] [41] [42] (./wise2.aux) LaTeX Warning: There were undefined references. LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on wise2.pdf (42 pages, 213068 bytes). Transcript written on wise2.log. cd docs && pdflatex wise2.tex This is pdfTeX, Version 3.141592653-2.6-1.40.22 (TeX Live 2022/dev/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./wise2.tex LaTeX2e <2021-11-15> patch level 1 L3 programming layer <2022-01-21> (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2021/10/04 v1.4n Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (/usr/share/texlive/texmf-dist/tex/latex/graphics/graphicx.sty (/usr/share/texlive/texmf-dist/tex/latex/graphics/keyval.sty) (/usr/share/texlive/texmf-dist/tex/latex/graphics/graphics.sty (/usr/share/texlive/texmf-dist/tex/latex/graphics/trig.sty) (/usr/share/texlive/texmf-dist/tex/latex/graphics-cfg/graphics.cfg) (/usr/share/texlive/texmf-dist/tex/latex/graphics-def/pdftex.def))) (/usr/share/texlive/texmf-dist/tex/latex/l3backend/l3backend-pdftex.def) (./wise2.aux) (/usr/share/texlive/texmf-dist/tex/context/base/mkii/supp-pdf.mkii [Loading MPS to PDF converter (version 2006.09.02).] ) (/usr/share/texlive/texmf-dist/tex/latex/epstopdf-pkg/epstopdf-base.sty (/usr/share/texlive/texmf-dist/tex/latex/latexconfig/epstopdf-sys.cfg)) [1{/var/lib/texmf/fonts/map/pdftex/updmap/pdftex.map}] (./wise2.toc [2]) [3] [4] [5] Overfull \hbox (11.99689pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 This program is freely distributed under a GPL. See source d irectory[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 Copyright (c) GRL limited: portions of the code are from sep arate copyright[] [6] Overfull \hbox (32.9967pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 Warning: The bits scores is not probablistically correct for single seqs[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 88 AQKSRPHKIDGRVVEPKRAVPRQ DID[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 A +RPHK+DGRVVEPKRAV R+ D[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 AMNARPHKVDGRVVEPKRAVSRE DSQ[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 1867 gaagaccagggagggcaaggtagGTGAGTG Intron 2 TAGgtc[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 ctacgcaataggttacagctcga<0-----[1936 : 2 083]-0>aca[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 tgtagacggtaatgaagatccaa tta[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 114 SPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDIN IVIDKETGKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 P A TVKK+FVG +K+D +E +RDYF+ +G I I I+ D+ +GKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIE IMTDRGSGKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 2093 acggctagaaatgggaaggaggcccagttgctgaaggag aaagcgagaa[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 gcgcatctaatttggtaaacaaaatgaataaagatatta ttcaggggaa[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 aatccatgagatttctaactaatcaatttagtaatagta cgtcactcga[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 163 RGFAFVEFDDYDPVDKVV QKQHQ[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RGFAFV FDD+D VDK+V QK H[] [7] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RGFAFVTFDDHDSVDKIV L:I[att] QKYHT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 2240 agtgtgatggcgtggaagAGTAAGTA Intron 3 TAGTTcatca[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 ggtcttctaaaactaatt <1-----[2295 : 2387] -1> aaaac[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 gctctactcctccgtgtc gactt[] Overfull \hbox (6.74693pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 tagaagatgactcaaatcgcccgag <1-----[2481 : 2793][] [8] [9] [10] [11] [12] [13] [14] [15] [16] [17] [18] LaTeX Warning: Reference `Figure:genewise21' on page 19 undefined on input line 708. [19] [20] [21] [22] Overfull \hbox (2.03789pt too wide) in paragraph at lines 965--968 []\OT1/cmr/m/n/10 Algorithms are named in two parts, \OT1/cmr/m/it/10 descripti ve-word state-number:transition- [23] [24] [25] [26] Overfull \hbox (68.08423pt too wide) in paragraph at lines 1108--1109 []\OT1/cmr/m/n/10 The half-wise pro-tein database, found at ftp://ftp.sanger.ac .uk/pub/birney/wise2/halfwise [27] [28] [29] Overfull \hbox (42.24687pt too wide) in paragraph at lines 1268--1268 []\OT1/cmtt/m/n/10 pexon [] Overfull \hbox (42.24687pt too wide) in paragraph at lines 1268--1268 []\OT1/cmtt/m/n/10 pexon [] [30] Overfull \hbox (36.99692pt too wide) in paragraph at lines 1312--1312 []\OT1/cmtt/m/n/10 Bits Query start end Target start end idel s introns[] Overfull \hbox (5.4972pt too wide) in paragraph at lines 1312--1312 []\OT1/cmtt/m/n/10 230.57 roa1_drome 26 347 HSHNRNPA 1386 3963 0 6[] [31] [32] [33] [34] [35] [36] [37] [38] [39] [40] [41] [42] [43] (./wise2.aux) LaTeX Warning: There were undefined references. LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on wise2.pdf (43 pages, 215369 bytes). Transcript written on wise2.log. cd docs && hevea api.tex ./api.tex:2: Warning: Command not found: \pdftrailerid ./api.tex:233: Warning: Undefined label: 'object_GeneFrequency' ./api.tex:236: Warning: Undefined label: 'module_gwrap' ./api.tex:237: Warning: Undefined label: 'module_gwrap' ./api.tex:238: Warning: Undefined label: 'module_gwrap' ./api.tex:239: Warning: Undefined label: 'module_gwrap' ./api.tex:389: Warning: Undefined label: 'module_gwrap' ./api.tex:426: Warning: Undefined label: 'module_codonmat' ./api.tex:435: Warning: Undefined label: 'module_dbimpl' ./api.tex:476: Warning: Application of '\'' on ',' failed ./api.tex:629: Warning: Application of '\'' on 't' failed ./api.tex:631: Warning: Application of '\'' on 'b' failed ./api.tex:633: Warning: Application of '\'' on 'b' failed ./api.tex:1642: Warning: Application of '\'' on 't' failed ./api.tex:1660: Warning: Application of '\'' on 't' failed ./api.tex:1882: Warning: Application of '\'' on '.' failed ./api.tex:2441: Warning: Application of '\'' on 'b' failed ./api.tex:2847: Warning: Application of '\'' on 'h' failed ./api.tex:2847: Warning: Application of '\'' on 't' failed ./api.tex:4435: Warning: Application of '\'' on '.' failed ./api.tex:4952: Warning: Application of '\'' on 'd' failed ./api.tex:4952: Warning: Application of '\'' on 'd' failed ./api.tex:5809: Warning: Application of '\'' on 'f' failed ./api.tex:5809: Warning: Application of '\'' on '[' failed ./api.tex:5830: Warning: Application of '\'' on 'f' failed ./api.tex:5830: Warning: Application of '\'' on '[' failed cd docs && hevea api.tex ./api.tex:2: Warning: Command not found: \pdftrailerid ./api.tex:233: Warning: Undefined label: 'object_GeneFrequency' ./api.tex:236: Warning: Undefined label: 'module_gwrap' ./api.tex:237: Warning: Undefined label: 'module_gwrap' ./api.tex:238: Warning: Undefined label: 'module_gwrap' ./api.tex:239: Warning: Undefined label: 'module_gwrap' ./api.tex:389: Warning: Undefined label: 'module_gwrap' ./api.tex:426: Warning: Undefined label: 'module_codonmat' ./api.tex:435: Warning: Undefined label: 'module_dbimpl' ./api.tex:476: Warning: Application of '\'' on ',' failed ./api.tex:629: Warning: Application of '\'' on 't' failed ./api.tex:631: Warning: Application of '\'' on 'b' failed ./api.tex:633: Warning: Application of '\'' on 'b' failed ./api.tex:1642: Warning: Application of '\'' on 't' failed ./api.tex:1660: Warning: Application of '\'' on 't' failed ./api.tex:1882: Warning: Application of '\'' on '.' failed ./api.tex:2441: Warning: Application of '\'' on 'b' failed ./api.tex:2847: Warning: Application of '\'' on 'h' failed ./api.tex:2847: Warning: Application of '\'' on 't' failed ./api.tex:4435: Warning: Application of '\'' on '.' failed ./api.tex:4952: Warning: Application of '\'' on 'd' failed ./api.tex:4952: Warning: Application of '\'' on 'd' failed ./api.tex:5809: Warning: Application of '\'' on 'f' failed ./api.tex:5809: Warning: Application of '\'' on '[' failed ./api.tex:5830: Warning: Application of '\'' on 'f' failed ./api.tex:5830: Warning: Application of '\'' on '[' failed cd docs && hevea dynamite.tex ./dynamite.tex:2: Warning: Command not found: \pdftrailerid ./dynamite.tex:2618: Warning: Command not found: \+ ./dynamite.tex:2618: Warning: Command not found: \* ./dynamite.tex:2619: Warning: Command not found: \* ./dynamite.tex:2756: Warning: Application of '\"' on ')' failed ./dynamite.tex:2756: Warning: Application of '\"' on ')' failed cd docs && hevea dynamite.tex ./dynamite.tex:2: Warning: Command not found: \pdftrailerid ./dynamite.tex:2618: Warning: Command not found: \+ ./dynamite.tex:2618: Warning: Command not found: \* ./dynamite.tex:2619: Warning: Command not found: \* ./dynamite.tex:2756: Warning: Application of '\"' on ')' failed ./dynamite.tex:2756: Warning: Application of '\"' on ')' failed cd docs && hevea wise2.tex ./wise2.tex:3: Warning: Command not found: \pdftrailerid ./wise2.tex:241: Warning: \hbox ./wise2.tex:243: Warning: \hbox ./wise2.tex:245: Warning: \hbox ./wise2.tex:247: Warning: \hbox ./wise2.tex:249: Warning: \hbox ./wise2.tex:251: Warning: \hbox ./wise2.tex:253: Warning: \hbox ./wise2.tex:255: Warning: \hbox ./wise2.tex:263: Warning: \hbox ./wise2.tex:265: Warning: \hbox ./wise2.tex:267: Warning: \hbox ./wise2.tex:269: Warning: \hbox ./wise2.tex:271: Warning: \hbox ./wise2.tex:273: Warning: \hbox ./wise2.tex:275: Warning: \hbox ./wise2.tex:277: Warning: \hbox ./wise2.tex:708: Warning: Undefined label: 'Figure:genewise21' ./wise2.tex:712: Warning: Command not found: \leavevmode ./wise2.tex:904: Warning: Command not found: \leavevmode cd docs && hevea wise2.tex ./wise2.tex:3: Warning: Command not found: \pdftrailerid ./wise2.tex:241: Warning: \hbox ./wise2.tex:243: Warning: \hbox ./wise2.tex:245: Warning: \hbox ./wise2.tex:247: Warning: \hbox ./wise2.tex:249: Warning: \hbox ./wise2.tex:251: Warning: \hbox ./wise2.tex:253: Warning: \hbox ./wise2.tex:255: Warning: \hbox ./wise2.tex:263: Warning: \hbox ./wise2.tex:265: Warning: \hbox ./wise2.tex:267: Warning: \hbox ./wise2.tex:269: Warning: \hbox ./wise2.tex:271: Warning: \hbox ./wise2.tex:273: Warning: \hbox ./wise2.tex:275: Warning: \hbox ./wise2.tex:277: Warning: \hbox ./wise2.tex:708: Warning: Undefined label: 'Figure:genewise21' ./wise2.tex:712: Warning: Command not found: \leavevmode ./wise2.tex:904: Warning: Command not found: \leavevmode mkdir -p docs/api mkdir -p docs/dynamite mkdir -p docs/wise2 mv docs/api.html docs/api mv docs/dynamite.html docs/dynamite mv docs/wise2.html docs/wise2 dh_auto_build make[1]: Leaving directory '/<>' create-stamp debian/debhelper-build-stamp dh_prep -a rm -f -- debian/wise.substvars rm -fr -- debian/.debhelper/generated/wise/ debian/wise/ debian/tmp/ dh_installdirs -a install -d debian/wise/usr/bin dh_install -a cp --reflink=auto -a ./src/bin/dba ./src/bin/dnal ./src/bin/estwise ./src/bin/estwisedb ./src/bin/genewise ./src/bin/genewisedb ./src/bin/promoterwise ./src/bin/psw ./src/bin/pswdb ./src/bin/scanwise ./src/bin/scanwise_server ./src/models/genomewise debian/wise/usr/bin/ install -d debian/.debhelper/generated/wise install -d debian/.debhelper/generated/wise-doc install -d debian/.debhelper/generated/wise-data dh_installdocs -a install -d debian/wise/usr/share/doc/wise cp --reflink=auto -a ./README debian/wise/usr/share/doc/wise cp --reflink=auto -a ./debian/tests/run-unit-test debian/wise/usr/share/doc/wise chmod -R u\+rw,go=rX debian/wise/usr/share/doc install -p -m0644 debian/README.Debian debian/wise/usr/share/doc/wise/README.Debian install -p -m0644 debian/copyright debian/wise/usr/share/doc/wise/copyright dh_installchangelogs -a install -p -m0644 debian/changelog debian/wise/usr/share/doc/wise/changelog.Debian dh_installexamples -a dh_installman -a install -d debian/wise/usr/share/man/man1/ install -p -m0644 ./debian/manpages.d/dba.1 debian/wise/usr/share/man/man1/dba.1 install -p -m0644 ./debian/manpages.d/dnal.1 debian/wise/usr/share/man/man1/dnal.1 install -p -m0644 ./debian/manpages.d/estwise.1 debian/wise/usr/share/man/man1/estwise.1 install -p -m0644 ./debian/manpages.d/estwisedb.1 debian/wise/usr/share/man/man1/estwisedb.1 install -p -m0644 ./debian/manpages.d/genewise.1 debian/wise/usr/share/man/man1/genewise.1 install -p -m0644 ./debian/manpages.d/genewisedb.1 debian/wise/usr/share/man/man1/genewisedb.1 install -p -m0644 ./debian/manpages.d/genomewise.1 debian/wise/usr/share/man/man1/genomewise.1 install -p -m0644 ./debian/manpages.d/promoterwise.1 debian/wise/usr/share/man/man1/promoterwise.1 install -p -m0644 ./debian/manpages.d/psw.1 debian/wise/usr/share/man/man1/psw.1 install -p -m0644 ./debian/manpages.d/pswdb.1 debian/wise/usr/share/man/man1/pswdb.1 install -p -m0644 ./debian/manpages.d/scanwise.1 debian/wise/usr/share/man/man1/scanwise.1 install -p -m0644 ./debian/manpages.d/scanwise_server.1 debian/wise/usr/share/man/man1/scanwise_server.1 man-recode --to-code UTF-8 --suffix .dh-new debian/wise/usr/share/man/man1/dba.1 debian/wise/usr/share/man/man1/dnal.1 man-recode --to-code UTF-8 --suffix .dh-new debian/wise/usr/share/man/man1/estwise.1 debian/wise/usr/share/man/man1/estwisedb.1 man-recode --to-code UTF-8 --suffix .dh-new debian/wise/usr/share/man/man1/genewise.1 debian/wise/usr/share/man/man1/genewisedb.1 man-recode --to-code UTF-8 --suffix .dh-new debian/wise/usr/share/man/man1/genomewise.1 debian/wise/usr/share/man/man1/promoterwise.1 man-recode --to-code UTF-8 --suffix .dh-new debian/wise/usr/share/man/man1/psw.1 debian/wise/usr/share/man/man1/pswdb.1 man-recode --to-code UTF-8 --suffix .dh-new debian/wise/usr/share/man/man1/scanwise.1 debian/wise/usr/share/man/man1/scanwise_server.1 mv debian/wise/usr/share/man/man1/genomewise.1.dh-new debian/wise/usr/share/man/man1/genomewise.1 mv debian/wise/usr/share/man/man1/promoterwise.1.dh-new debian/wise/usr/share/man/man1/promoterwise.1 chmod 0644 -- debian/wise/usr/share/man/man1/genomewise.1 debian/wise/usr/share/man/man1/promoterwise.1 mv debian/wise/usr/share/man/man1/dba.1.dh-new debian/wise/usr/share/man/man1/dba.1 mv debian/wise/usr/share/man/man1/dnal.1.dh-new debian/wise/usr/share/man/man1/dnal.1 chmod 0644 -- debian/wise/usr/share/man/man1/dba.1 debian/wise/usr/share/man/man1/dnal.1 mv debian/wise/usr/share/man/man1/genewise.1.dh-new debian/wise/usr/share/man/man1/genewise.1 mv debian/wise/usr/share/man/man1/genewisedb.1.dh-new debian/wise/usr/share/man/man1/genewisedb.1 chmod 0644 -- debian/wise/usr/share/man/man1/genewise.1 debian/wise/usr/share/man/man1/genewisedb.1 mv debian/wise/usr/share/man/man1/estwise.1.dh-new debian/wise/usr/share/man/man1/estwise.1 mv debian/wise/usr/share/man/man1/estwisedb.1.dh-new debian/wise/usr/share/man/man1/estwisedb.1 chmod 0644 -- debian/wise/usr/share/man/man1/estwise.1 debian/wise/usr/share/man/man1/estwisedb.1 mv debian/wise/usr/share/man/man1/scanwise.1.dh-new debian/wise/usr/share/man/man1/scanwise.1 mv debian/wise/usr/share/man/man1/scanwise_server.1.dh-new debian/wise/usr/share/man/man1/scanwise_server.1 chmod 0644 -- debian/wise/usr/share/man/man1/scanwise.1 debian/wise/usr/share/man/man1/scanwise_server.1 mv debian/wise/usr/share/man/man1/psw.1.dh-new debian/wise/usr/share/man/man1/psw.1 mv debian/wise/usr/share/man/man1/pswdb.1.dh-new debian/wise/usr/share/man/man1/pswdb.1 chmod 0644 -- debian/wise/usr/share/man/man1/psw.1 debian/wise/usr/share/man/man1/pswdb.1 dh_perl -a dh_link -a dh_strip_nondeterminism -a dh_compress -a cd debian/wise chmod a-x usr/share/doc/wise/changelog.Debian usr/share/man/man1/dba.1 usr/share/man/man1/dnal.1 usr/share/man/man1/estwise.1 usr/share/man/man1/estwisedb.1 usr/share/man/man1/genewise.1 usr/share/man/man1/genewisedb.1 usr/share/man/man1/genomewise.1 usr/share/man/man1/promoterwise.1 usr/share/man/man1/psw.1 usr/share/man/man1/pswdb.1 usr/share/man/man1/scanwise.1 usr/share/man/man1/scanwise_server.1 gzip -9nf usr/share/doc/wise/changelog.Debian usr/share/man/man1/dba.1 usr/share/man/man1/dnal.1 usr/share/man/man1/estwise.1 usr/share/man/man1/estwisedb.1 usr/share/man/man1/genewise.1 usr/share/man/man1/genewisedb.1 usr/share/man/man1/genomewise.1 usr/share/man/man1/promoterwise.1 usr/share/man/man1/psw.1 usr/share/man/man1/pswdb.1 usr/share/man/man1/scanwise.1 usr/share/man/man1/scanwise_server.1 cd '/<>' rm -f debian/wise.debhelper.log debian/rules override_dh_fixperms make[1]: Entering directory '/<>' dh_fixperms find debian/wise ! -type l -a -true -a -true -print0 2>/dev/null | xargs -0r chmod go=rX,u+rw,a-s find debian/wise/usr/share/doc -type f -a -true -a ! -regex 'debian/wise/usr/share/doc/[^/]*/examples/.*' -print0 2>/dev/null | xargs -0r chmod 0644 find debian/wise/usr/share/doc -type d -a -true -a -true -print0 2>/dev/null | xargs -0r chmod 0755 find debian/wise/usr/share/man -type f -a -true -a -true -print0 2>/dev/null | xargs -0r chmod 0644 find debian/wise -type f \( -name '*.so.*' -o -name '*.so' -o -name '*.la' -o -name '*.a' -o -name '*.js' -o -name '*.css' -o -name '*.scss' -o -name '*.sass' -o -name '*.jpeg' -o -name '*.jpg' -o -name '*.png' -o -name '*.gif' -o -name '*.cmxs' -o -name '*.node' \) -a -true -a -true -print0 2>/dev/null | xargs -0r chmod 0644 find debian/wise/usr/bin -type f -a -true -a -true -print0 2>/dev/null | xargs -0r chmod a+x find debian -iname "*.hmm" -exec chmod -x \{\} \; make[1]: Leaving directory '/<>' dh_missing -a dh_dwz -a install -d debian/wise/usr/lib/debug/.dwz/riscv64-linux-gnu dwz -mdebian/wise/usr/lib/debug/.dwz/riscv64-linux-gnu/wise.debug -M/usr/lib/debug/.dwz/riscv64-linux-gnu/wise.debug -- debian/wise/usr/bin/dba debian/wise/usr/bin/dnal debian/wise/usr/bin/estwise debian/wise/usr/bin/estwisedb debian/wise/usr/bin/genewise debian/wise/usr/bin/genewisedb debian/wise/usr/bin/genomewise debian/wise/usr/bin/promoterwise debian/wise/usr/bin/psw debian/wise/usr/bin/pswdb debian/wise/usr/bin/scanwise debian/wise/usr/bin/scanwise_server objcopy --compress-debug-sections debian/wise/usr/lib/debug/.dwz/riscv64-linux-gnu/wise.debug dh_strip -a debugedit --build-id --build-id-seed=wise/2.4.1-23 debian/wise/usr/bin/genewise debugedit: debian/wise/usr/bin/genewise: Unknown DWARF DW_FORM_0x1f21 380e798c9acdca67e238742da3f8d7e7e6e87663 install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/38 objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/genewise debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/38/0e798c9acdca67e238742da3f8d7e7e6e87663.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/38/0e798c9acdca67e238742da3f8d7e7e6e87663.debug strip --remove-section=.comment --remove-section=.note -o /tmp/9ftmS14Rir/strip0ifvli debian/wise/usr/bin/genewise chmod --reference debian/wise/usr/bin/genewise /tmp/9ftmS14Rir/strip0ifvli cat '/tmp/9ftmS14Rir/strip0ifvli' > 'debian/wise/usr/bin/genewise' chmod --reference /tmp/9ftmS14Rir/strip0ifvli debian/wise/usr/bin/genewise objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/38/0e798c9acdca67e238742da3f8d7e7e6e87663.debug debian/wise/usr/bin/genewise /tmp/9ftmS14Rir/objcopy7scXuP chmod --reference debian/wise/usr/bin/genewise /tmp/9ftmS14Rir/objcopy7scXuP cat '/tmp/9ftmS14Rir/objcopy7scXuP' > 'debian/wise/usr/bin/genewise' chmod --reference /tmp/9ftmS14Rir/objcopy7scXuP debian/wise/usr/bin/genewise debugedit --build-id --build-id-seed=wise/2.4.1-23 debian/wise/usr/bin/scanwise_server debugedit: debian/wise/usr/bin/scanwise_server: Unknown DWARF DW_FORM_0x1f20 0efb4042205f1b9db62e5825d0c4cbba71c64de6 install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/0e objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/scanwise_server debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/0e/fb4042205f1b9db62e5825d0c4cbba71c64de6.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/0e/fb4042205f1b9db62e5825d0c4cbba71c64de6.debug strip --remove-section=.comment --remove-section=.note -o /tmp/9ftmS14Rir/stripXW3Jur debian/wise/usr/bin/scanwise_server chmod --reference debian/wise/usr/bin/scanwise_server /tmp/9ftmS14Rir/stripXW3Jur cat '/tmp/9ftmS14Rir/stripXW3Jur' > 'debian/wise/usr/bin/scanwise_server' chmod --reference /tmp/9ftmS14Rir/stripXW3Jur debian/wise/usr/bin/scanwise_server objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/0e/fb4042205f1b9db62e5825d0c4cbba71c64de6.debug debian/wise/usr/bin/scanwise_server /tmp/9ftmS14Rir/objcopyNGC81t chmod --reference debian/wise/usr/bin/scanwise_server /tmp/9ftmS14Rir/objcopyNGC81t cat '/tmp/9ftmS14Rir/objcopyNGC81t' > 'debian/wise/usr/bin/scanwise_server' chmod --reference /tmp/9ftmS14Rir/objcopyNGC81t debian/wise/usr/bin/scanwise_server debugedit --build-id --build-id-seed=wise/2.4.1-23 debian/wise/usr/bin/genewisedb debugedit: debian/wise/usr/bin/genewisedb: Unknown DWARF DW_FORM_0x1f20 ecb0b52cf3f71ccf1b34912cb1b15093d9fc5929 install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/ec objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/genewisedb debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/ec/b0b52cf3f71ccf1b34912cb1b15093d9fc5929.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/ec/b0b52cf3f71ccf1b34912cb1b15093d9fc5929.debug strip --remove-section=.comment --remove-section=.note -o /tmp/9ftmS14Rir/stripAVW1og debian/wise/usr/bin/genewisedb chmod --reference debian/wise/usr/bin/genewisedb /tmp/9ftmS14Rir/stripAVW1og cat '/tmp/9ftmS14Rir/stripAVW1og' > 'debian/wise/usr/bin/genewisedb' chmod --reference /tmp/9ftmS14Rir/stripAVW1og debian/wise/usr/bin/genewisedb objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/ec/b0b52cf3f71ccf1b34912cb1b15093d9fc5929.debug debian/wise/usr/bin/genewisedb /tmp/9ftmS14Rir/objcopyMWSP_n chmod --reference debian/wise/usr/bin/genewisedb /tmp/9ftmS14Rir/objcopyMWSP_n cat '/tmp/9ftmS14Rir/objcopyMWSP_n' > 'debian/wise/usr/bin/genewisedb' chmod --reference /tmp/9ftmS14Rir/objcopyMWSP_n debian/wise/usr/bin/genewisedb debugedit --build-id --build-id-seed=wise/2.4.1-23 debian/wise/usr/bin/pswdb debugedit: debian/wise/usr/bin/pswdb: Unknown DWARF DW_FORM_0x1f20 5b14e5129fe31e069ca68de9481be5ddbdb070aa install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/5b objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/pswdb debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/5b/14e5129fe31e069ca68de9481be5ddbdb070aa.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/5b/14e5129fe31e069ca68de9481be5ddbdb070aa.debug strip --remove-section=.comment --remove-section=.note -o /tmp/9ftmS14Rir/stripcLVhoP debian/wise/usr/bin/pswdb chmod --reference debian/wise/usr/bin/pswdb /tmp/9ftmS14Rir/stripcLVhoP cat '/tmp/9ftmS14Rir/stripcLVhoP' > 'debian/wise/usr/bin/pswdb' chmod --reference /tmp/9ftmS14Rir/stripcLVhoP debian/wise/usr/bin/pswdb objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/5b/14e5129fe31e069ca68de9481be5ddbdb070aa.debug debian/wise/usr/bin/pswdb /tmp/9ftmS14Rir/objcopy3y9JDn chmod --reference debian/wise/usr/bin/pswdb /tmp/9ftmS14Rir/objcopy3y9JDn cat '/tmp/9ftmS14Rir/objcopy3y9JDn' > 'debian/wise/usr/bin/pswdb' chmod --reference /tmp/9ftmS14Rir/objcopy3y9JDn debian/wise/usr/bin/pswdb debugedit --build-id --build-id-seed=wise/2.4.1-23 debian/wise/usr/bin/genomewise debugedit: debian/wise/usr/bin/genomewise: Unknown DWARF DW_FORM_0x1f21 0e31b5c6401089a8e4dd414064e779f753d2782c objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/genomewise debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/0e/31b5c6401089a8e4dd414064e779f753d2782c.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/0e/31b5c6401089a8e4dd414064e779f753d2782c.debug strip --remove-section=.comment --remove-section=.note -o /tmp/9ftmS14Rir/strip_JaQjU debian/wise/usr/bin/genomewise chmod --reference debian/wise/usr/bin/genomewise /tmp/9ftmS14Rir/strip_JaQjU cat '/tmp/9ftmS14Rir/strip_JaQjU' > 'debian/wise/usr/bin/genomewise' chmod --reference /tmp/9ftmS14Rir/strip_JaQjU debian/wise/usr/bin/genomewise objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/0e/31b5c6401089a8e4dd414064e779f753d2782c.debug debian/wise/usr/bin/genomewise /tmp/9ftmS14Rir/objcopyJ7xgTB chmod --reference debian/wise/usr/bin/genomewise /tmp/9ftmS14Rir/objcopyJ7xgTB cat '/tmp/9ftmS14Rir/objcopyJ7xgTB' > 'debian/wise/usr/bin/genomewise' chmod --reference /tmp/9ftmS14Rir/objcopyJ7xgTB debian/wise/usr/bin/genomewise debugedit --build-id --build-id-seed=wise/2.4.1-23 debian/wise/usr/bin/estwisedb debugedit: debian/wise/usr/bin/estwisedb: Unknown DWARF DW_FORM_0x1f20 56047995436ee8e176bc771a2b6fe9f63663fcc8 install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/56 objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/estwisedb debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/56/047995436ee8e176bc771a2b6fe9f63663fcc8.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/56/047995436ee8e176bc771a2b6fe9f63663fcc8.debug strip --remove-section=.comment --remove-section=.note -o /tmp/9ftmS14Rir/stripBq_ZZI debian/wise/usr/bin/estwisedb chmod --reference debian/wise/usr/bin/estwisedb /tmp/9ftmS14Rir/stripBq_ZZI cat '/tmp/9ftmS14Rir/stripBq_ZZI' > 'debian/wise/usr/bin/estwisedb' chmod --reference /tmp/9ftmS14Rir/stripBq_ZZI debian/wise/usr/bin/estwisedb objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/56/047995436ee8e176bc771a2b6fe9f63663fcc8.debug debian/wise/usr/bin/estwisedb /tmp/9ftmS14Rir/objcopyBiPHDm chmod --reference debian/wise/usr/bin/estwisedb /tmp/9ftmS14Rir/objcopyBiPHDm cat '/tmp/9ftmS14Rir/objcopyBiPHDm' > 'debian/wise/usr/bin/estwisedb' chmod --reference /tmp/9ftmS14Rir/objcopyBiPHDm debian/wise/usr/bin/estwisedb debugedit --build-id --build-id-seed=wise/2.4.1-23 debian/wise/usr/bin/psw debugedit: debian/wise/usr/bin/psw: Unknown DWARF DW_FORM_0x1f20 754c9b1fe93048732822ccf6849cef9f9e999b13 install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/75 objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/psw debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/75/4c9b1fe93048732822ccf6849cef9f9e999b13.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/75/4c9b1fe93048732822ccf6849cef9f9e999b13.debug strip --remove-section=.comment --remove-section=.note -o /tmp/9ftmS14Rir/strip7y0Rui debian/wise/usr/bin/psw chmod --reference debian/wise/usr/bin/psw /tmp/9ftmS14Rir/strip7y0Rui cat '/tmp/9ftmS14Rir/strip7y0Rui' > 'debian/wise/usr/bin/psw' chmod --reference /tmp/9ftmS14Rir/strip7y0Rui debian/wise/usr/bin/psw objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/75/4c9b1fe93048732822ccf6849cef9f9e999b13.debug debian/wise/usr/bin/psw /tmp/9ftmS14Rir/objcopyhEncBG chmod --reference debian/wise/usr/bin/psw /tmp/9ftmS14Rir/objcopyhEncBG cat '/tmp/9ftmS14Rir/objcopyhEncBG' > 'debian/wise/usr/bin/psw' chmod --reference /tmp/9ftmS14Rir/objcopyhEncBG debian/wise/usr/bin/psw debugedit --build-id --build-id-seed=wise/2.4.1-23 debian/wise/usr/bin/dba debugedit: debian/wise/usr/bin/dba: Unknown DWARF DW_FORM_0x1f21 44865791d8d2b5a578881c2e22304e4b09bd6293 install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/44 objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/dba debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/44/865791d8d2b5a578881c2e22304e4b09bd6293.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/44/865791d8d2b5a578881c2e22304e4b09bd6293.debug strip --remove-section=.comment --remove-section=.note -o /tmp/9ftmS14Rir/stripmitBnb debian/wise/usr/bin/dba chmod --reference debian/wise/usr/bin/dba /tmp/9ftmS14Rir/stripmitBnb cat '/tmp/9ftmS14Rir/stripmitBnb' > 'debian/wise/usr/bin/dba' chmod --reference /tmp/9ftmS14Rir/stripmitBnb debian/wise/usr/bin/dba objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/44/865791d8d2b5a578881c2e22304e4b09bd6293.debug debian/wise/usr/bin/dba /tmp/9ftmS14Rir/objcopyYSfuAU chmod --reference debian/wise/usr/bin/dba /tmp/9ftmS14Rir/objcopyYSfuAU cat '/tmp/9ftmS14Rir/objcopyYSfuAU' > 'debian/wise/usr/bin/dba' chmod --reference /tmp/9ftmS14Rir/objcopyYSfuAU debian/wise/usr/bin/dba debugedit --build-id --build-id-seed=wise/2.4.1-23 debian/wise/usr/bin/estwise debugedit: debian/wise/usr/bin/estwise: Unknown DWARF DW_FORM_0x1f20 e738170cc3fe125c40b69075dfcd9dab2b22b280 install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/e7 objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/estwise debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/e7/38170cc3fe125c40b69075dfcd9dab2b22b280.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/e7/38170cc3fe125c40b69075dfcd9dab2b22b280.debug strip --remove-section=.comment --remove-section=.note -o /tmp/9ftmS14Rir/stripmCLFJ_ debian/wise/usr/bin/estwise chmod --reference debian/wise/usr/bin/estwise /tmp/9ftmS14Rir/stripmCLFJ_ cat '/tmp/9ftmS14Rir/stripmCLFJ_' > 'debian/wise/usr/bin/estwise' chmod --reference /tmp/9ftmS14Rir/stripmCLFJ_ debian/wise/usr/bin/estwise objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/e7/38170cc3fe125c40b69075dfcd9dab2b22b280.debug debian/wise/usr/bin/estwise /tmp/9ftmS14Rir/objcopyxldjwv chmod --reference debian/wise/usr/bin/estwise /tmp/9ftmS14Rir/objcopyxldjwv cat '/tmp/9ftmS14Rir/objcopyxldjwv' > 'debian/wise/usr/bin/estwise' chmod --reference /tmp/9ftmS14Rir/objcopyxldjwv debian/wise/usr/bin/estwise debugedit --build-id --build-id-seed=wise/2.4.1-23 debian/wise/usr/bin/promoterwise debugedit: debian/wise/usr/bin/promoterwise: Unknown DWARF DW_FORM_0x1f21 fbe928dc3f7fd1b73cf99d5be8a7c52362f47fbf install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/fb objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/promoterwise debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/fb/e928dc3f7fd1b73cf99d5be8a7c52362f47fbf.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/fb/e928dc3f7fd1b73cf99d5be8a7c52362f47fbf.debug strip --remove-section=.comment --remove-section=.note -o /tmp/9ftmS14Rir/striprdLPLJ debian/wise/usr/bin/promoterwise chmod --reference debian/wise/usr/bin/promoterwise /tmp/9ftmS14Rir/striprdLPLJ cat '/tmp/9ftmS14Rir/striprdLPLJ' > 'debian/wise/usr/bin/promoterwise' chmod --reference /tmp/9ftmS14Rir/striprdLPLJ debian/wise/usr/bin/promoterwise objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/fb/e928dc3f7fd1b73cf99d5be8a7c52362f47fbf.debug debian/wise/usr/bin/promoterwise /tmp/9ftmS14Rir/objcopyFkCDcG chmod --reference debian/wise/usr/bin/promoterwise /tmp/9ftmS14Rir/objcopyFkCDcG cat '/tmp/9ftmS14Rir/objcopyFkCDcG' > 'debian/wise/usr/bin/promoterwise' chmod --reference /tmp/9ftmS14Rir/objcopyFkCDcG debian/wise/usr/bin/promoterwise debugedit --build-id --build-id-seed=wise/2.4.1-23 debian/wise/usr/bin/scanwise debugedit: debian/wise/usr/bin/scanwise: Unknown DWARF DW_FORM_0x1f21 09b3c9d7d5d65e6ed6d0ecc51e6fe686bf1e6e11 install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/09 objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/scanwise debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/09/b3c9d7d5d65e6ed6d0ecc51e6fe686bf1e6e11.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/09/b3c9d7d5d65e6ed6d0ecc51e6fe686bf1e6e11.debug strip --remove-section=.comment --remove-section=.note -o /tmp/9ftmS14Rir/striphGxRXP debian/wise/usr/bin/scanwise chmod --reference debian/wise/usr/bin/scanwise /tmp/9ftmS14Rir/striphGxRXP cat '/tmp/9ftmS14Rir/striphGxRXP' > 'debian/wise/usr/bin/scanwise' chmod --reference /tmp/9ftmS14Rir/striphGxRXP debian/wise/usr/bin/scanwise objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/09/b3c9d7d5d65e6ed6d0ecc51e6fe686bf1e6e11.debug debian/wise/usr/bin/scanwise /tmp/9ftmS14Rir/objcopyfpPkGx chmod --reference debian/wise/usr/bin/scanwise /tmp/9ftmS14Rir/objcopyfpPkGx cat '/tmp/9ftmS14Rir/objcopyfpPkGx' > 'debian/wise/usr/bin/scanwise' chmod --reference /tmp/9ftmS14Rir/objcopyfpPkGx debian/wise/usr/bin/scanwise debugedit --build-id --build-id-seed=wise/2.4.1-23 debian/wise/usr/bin/dnal debugedit: debian/wise/usr/bin/dnal: Unknown DWARF DW_FORM_0x1f21 539bed14820d13fe1e4fdd46f03eff71632f4593 install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/53 objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/dnal debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/53/9bed14820d13fe1e4fdd46f03eff71632f4593.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/53/9bed14820d13fe1e4fdd46f03eff71632f4593.debug strip --remove-section=.comment --remove-section=.note -o /tmp/9ftmS14Rir/stripmETWmo debian/wise/usr/bin/dnal chmod --reference debian/wise/usr/bin/dnal /tmp/9ftmS14Rir/stripmETWmo cat '/tmp/9ftmS14Rir/stripmETWmo' > 'debian/wise/usr/bin/dnal' chmod --reference /tmp/9ftmS14Rir/stripmETWmo debian/wise/usr/bin/dnal objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/53/9bed14820d13fe1e4fdd46f03eff71632f4593.debug debian/wise/usr/bin/dnal /tmp/9ftmS14Rir/objcopyhThvad chmod --reference debian/wise/usr/bin/dnal /tmp/9ftmS14Rir/objcopyhThvad cat '/tmp/9ftmS14Rir/objcopyhThvad' > 'debian/wise/usr/bin/dnal' chmod --reference /tmp/9ftmS14Rir/objcopyhThvad debian/wise/usr/bin/dnal install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.dwz cp --reflink=auto -a debian/wise/usr/lib/debug/.dwz/riscv64-linux-gnu debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.dwz rm -fr debian/wise/usr/lib/debug/.dwz rmdir -p --ignore-fail-on-non-empty debian/wise/usr/lib/debug rm -fr debian/.debhelper/wise/dbgsym-root dh_makeshlibs -a rm -f debian/wise/DEBIAN/shlibs dh_shlibdeps -a install -d debian/wise/DEBIAN dpkg-shlibdeps -Tdebian/wise.substvars debian/wise/usr/bin/genewise debian/wise/usr/bin/scanwise_server debian/wise/usr/bin/genewisedb debian/wise/usr/bin/pswdb debian/wise/usr/bin/genomewise debian/wise/usr/bin/estwisedb debian/wise/usr/bin/psw debian/wise/usr/bin/dba debian/wise/usr/bin/estwise debian/wise/usr/bin/promoterwise debian/wise/usr/bin/scanwise debian/wise/usr/bin/dnal dh_installdeb -a dh_gencontrol -a echo misc:Depends= >> debian/wise.substvars echo misc:Pre-Depends= >> debian/wise.substvars dpkg-gencontrol -pwise -ldebian/changelog -Tdebian/wise.substvars -Pdebian/wise chmod 0644 -- debian/wise/DEBIAN/control dh_md5sums -a cd debian/wise >/dev/null && xargs -r0 md5sum | perl -pe 'if (s@^\\@@) { s/\\\\/\\/g; }' > DEBIAN/md5sums chmod 0644 -- debian/wise/DEBIAN/md5sums dh_builddeb -a dpkg-deb --root-owner-group --build debian/wise .. INFO: pkgstriptranslations version 149 pkgstriptranslations: processing wise (in debian/wise); do_strip: , oemstrip: pkgmaintainermangler: Maintainer field overridden to "Ubuntu Developers " pkgstripfiles: processing control file: debian/wise/DEBIAN/control, package wise, directory debian/wise pkgstripfiles: Truncating usr/share/doc/wise/changelog.Debian.gz to topmost ten records pkgstripfiles: Running PNG optimization (using 8 cpus) for package wise ... pkgstripfiles: No PNG files. dpkg-deb: building package 'wise' in '../wise_2.4.1-23_riscv64.deb'. dpkg-genbuildinfo --build=any -O../wise_2.4.1-23_riscv64.buildinfo dpkg-genchanges --build=any -mLaunchpad Build Daemon -O../wise_2.4.1-23_riscv64.changes dpkg-genchanges: info: binary-only arch-specific upload (source code and arch-indep packages not included) dpkg-source --after-build . dpkg-buildpackage.pl: info: binary-only upload (no source included) === USAGE-SUMMARY BEGIN === SUMMARY: host: riscv64-qemu-lcy01-030; CPUs: 8/8; CPU avg: 41%; CPU max: 100%; base memory: 0.3 GB; peak memory: 0.9 GB; total memory: 15.6 GB SUMMARY: swap peak/total: 0.0/0.0 GB; disk start/end/total: 7.3/7.5/68.4 GB; disk delta: 0.2 GB === USAGE-SUMMARY END === -------------------------------------------------------------------------------- Build finished at 2022-04-23T01:37:59Z Finished -------- I: Built successfully +------------------------------------------------------------------------------+ | Changes | +------------------------------------------------------------------------------+ wise_2.4.1-23_riscv64.changes: ------------------------------ Format: 1.8 Date: Sat, 18 Apr 2020 17:57:01 +0200 Source: wise Binary: wise Built-For-Profiles: noudeb Architecture: riscv64 Version: 2.4.1-23 Distribution: jammy Urgency: medium Maintainer: Launchpad Build Daemon Changed-By: Helmut Grohne Description: wise - comparison of biopolymers, like DNA and protein sequences Closes: 958094 Changes: wise (2.4.1-23) unstable; urgency=medium . * Team upload. * Do not hard code the build architecture pkg-config Closes: #958094 Checksums-Sha1: 1cc5bce0e1ada0d15b5947973d21d9b28d340e84 9847 wise_2.4.1-23_riscv64.buildinfo 3b0e09d4f4c4f2d678eb4a7e2f3b250d569ed79b 985560 wise_2.4.1-23_riscv64.deb Checksums-Sha256: 6c915f8411129aeb71fc073ec0e4f0f9416af52d81b56ba2efeeb7b0e322c0cc 9847 wise_2.4.1-23_riscv64.buildinfo 52b1748fb941d166af94def40dee9ab082d37137f10b2ffa0802962730d3974f 985560 wise_2.4.1-23_riscv64.deb Files: 1b44ffb6ef432a80bacec5ad2918b14f 9847 science optional wise_2.4.1-23_riscv64.buildinfo 2303720444616501dcd722a05956ed27 985560 science optional wise_2.4.1-23_riscv64.deb /<>/wise_2.4.1-23_riscv64.changes.new could not be renamed to /<>/wise_2.4.1-23_riscv64.changes: Illegal seek Distribution field may be wrong!!! +------------------------------------------------------------------------------+ | Buildinfo | +------------------------------------------------------------------------------+ Format: 1.0 Source: wise Binary: wise Architecture: riscv64 Version: 2.4.1-23 Checksums-Md5: 2303720444616501dcd722a05956ed27 985560 wise_2.4.1-23_riscv64.deb Checksums-Sha1: 3b0e09d4f4c4f2d678eb4a7e2f3b250d569ed79b 985560 wise_2.4.1-23_riscv64.deb Checksums-Sha256: 52b1748fb941d166af94def40dee9ab082d37137f10b2ffa0802962730d3974f 985560 wise_2.4.1-23_riscv64.deb Build-Origin: Ubuntu Build-Architecture: riscv64 Build-Date: Sat, 23 Apr 2022 01:37:51 +0000 Build-Path: /<> Build-Tainted-By: merged-usr-via-aliased-dirs usr-local-has-programs Installed-Build-Depends: autoconf (= 2.71-2), automake (= 1:1.16.5-1.3), autopoint (= 0.21-4ubuntu4), autotools-dev (= 20220109.1), base-files (= 12ubuntu4), base-passwd (= 3.5.52build1), bash (= 5.1-6ubuntu1), binutils (= 2.38-3ubuntu1), binutils-common (= 2.38-3ubuntu1), binutils-riscv64-linux-gnu (= 2.38-3ubuntu1), bsdextrautils (= 2.37.2-4ubuntu3), bsdutils (= 1:2.37.2-4ubuntu3), build-essential (= 12.9ubuntu3), bzip2 (= 1.0.8-5build1), coreutils (= 8.32-4.1ubuntu1), cpp (= 4:12-20211211-1ubuntu2), cpp-11 (= 11.2.0-19ubuntu1), cpp-12 (= 12-20220319-1ubuntu1), dash (= 0.5.11+git20210903+057cd650a4ed-3build1), debconf (= 1.5.79ubuntu1), debhelper (= 13.6ubuntu1), debianutils (= 5.5-1ubuntu2), debugedit (= 1:5.0-4build1), dh-autoreconf (= 20), dh-strip-nondeterminism (= 1.13.0-1), diffutils (= 1:3.8-0ubuntu2), docbook (= 4.5-9), docbook-to-man (= 1:2.0.0-45), dpkg (= 1.21.1ubuntu11), dpkg-dev (= 1.21.1ubuntu11), dwz (= 0.14-1build2), file (= 1:5.41-3), findutils (= 4.8.0-1ubuntu3), fontconfig-config (= 2.13.1-4.2ubuntu5), fonts-dejavu-core (= 2.37-2build1), fonts-lmodern (= 2.004.5-6.1), fonts-urw-base35 (= 20200910-1), g++ (= 4:12-20211211-1ubuntu2), g++-12 (= 12-20220319-1ubuntu1), gcc (= 4:12-20211211-1ubuntu2), gcc-11 (= 11.2.0-19ubuntu1), gcc-11-base (= 11.2.0-19ubuntu1), gcc-12 (= 12-20220319-1ubuntu1), gcc-12-base (= 12-20220319-1ubuntu1), gettext (= 0.21-4ubuntu4), gettext-base (= 0.21-4ubuntu4), ghostscript (= 9.55.0~dfsg1-0ubuntu5), grep (= 3.7-1build1), groff-base (= 1.22.4-8build1), gzip (= 1.10-4ubuntu4), hevea (= 2.35-1build1), hostname (= 3.23ubuntu2), init-system-helpers (= 1.62), intltool-debian (= 0.35.0+20060710.5), libacl1 (= 2.3.1-1), libarchive-zip-perl (= 1.68-1), libasan6 (= 11.2.0-19ubuntu1), libasan8 (= 12-20220319-1ubuntu1), libatomic1 (= 12-20220319-1ubuntu1), libattr1 (= 1:2.5.1-1build1), libaudit-common (= 1:3.0.7-1build1), libaudit1 (= 1:3.0.7-1build1), libavahi-client3 (= 0.8-5ubuntu5), libavahi-common-data (= 0.8-5ubuntu5), libavahi-common3 (= 0.8-5ubuntu5), libbinutils (= 2.38-3ubuntu1), libblkid-dev (= 2.37.2-4ubuntu3), libblkid1 (= 2.37.2-4ubuntu3), libbrotli1 (= 1.0.9-2build6), libbsd0 (= 0.11.5-1), libbz2-1.0 (= 1.0.8-5build1), libc-bin (= 2.35-0ubuntu3), libc-dev-bin (= 2.35-0ubuntu3), libc6 (= 2.35-0ubuntu3), libc6-dev (= 2.35-0ubuntu3), libcairo2 (= 1.16.0-5ubuntu2), libcap-ng0 (= 0.7.9-2.2build3), libcap2 (= 1:2.44-1build3), libcc1-0 (= 12-20220319-1ubuntu1), libcom-err2 (= 1.46.5-2ubuntu1), libcrypt-dev (= 1:4.4.27-1), libcrypt1 (= 1:4.4.27-1), libctf-nobfd0 (= 2.38-3ubuntu1), libctf0 (= 2.38-3ubuntu1), libcups2 (= 2.4.1op1-1ubuntu4), libdatrie1 (= 0.2.13-2), libdb5.3 (= 5.3.28+dfsg1-0.8ubuntu3), libdbus-1-3 (= 1.12.20-2ubuntu4), libdebconfclient0 (= 0.261ubuntu1), libdebhelper-perl (= 13.6ubuntu1), libdeflate0 (= 1.10-2), libdpkg-perl (= 1.21.1ubuntu11), libdw1 (= 0.186-1build1), libelf1 (= 0.186-1build1), libexpat1 (= 2.4.7-1), libffi-dev (= 3.4.2-4), libffi8 (= 3.4.2-4), libfile-stripnondeterminism-perl (= 1.13.0-1), libfontconfig1 (= 2.13.1-4.2ubuntu5), libfontenc1 (= 1:1.1.4-1build3), libfreetype6 (= 2.11.1+dfsg-1build1), libgcc-11-dev (= 11.2.0-19ubuntu1), libgcc-12-dev (= 12-20220319-1ubuntu1), libgcc-s1 (= 12-20220319-1ubuntu1), libgcrypt20 (= 1.9.4-3ubuntu3), libgdbm-compat4 (= 1.23-1), libgdbm6 (= 1.23-1), libglib2.0-0 (= 2.72.1-1), libglib2.0-bin (= 2.72.1-1), libglib2.0-data (= 2.72.1-1), libglib2.0-dev (= 2.72.1-1), libglib2.0-dev-bin (= 2.72.1-1), libgmp10 (= 2:6.2.1+dfsg-3ubuntu1), libgnutls30 (= 3.7.3-4ubuntu1), libgomp1 (= 12-20220319-1ubuntu1), libgpg-error0 (= 1.43-3), libgraphite2-3 (= 1.3.14-1build2), libgs9 (= 9.55.0~dfsg1-0ubuntu5), libgs9-common (= 9.55.0~dfsg1-0ubuntu5), libgssapi-krb5-2 (= 1.19.2-2), libharfbuzz0b (= 2.7.4-1ubuntu3), libhogweed6 (= 3.7.3-1build2), libice6 (= 2:1.0.10-1build2), libicu70 (= 70.1-2), libidn12 (= 1.38-4build1), libidn2-0 (= 2.3.2-2build1), libijs-0.35 (= 0.35-15build2), libisl23 (= 0.24-2build1), libjbig0 (= 2.1-3.1build3), libjbig2dec0 (= 0.19-3build2), libjpeg-turbo8 (= 2.1.2-0ubuntu1), libjpeg8 (= 8c-2ubuntu10), libjs-jquery (= 3.6.0+dfsg+~3.5.13-1), libk5crypto3 (= 1.19.2-2), libkeyutils1 (= 1.6.1-2ubuntu3), libkpathsea6 (= 2021.20210626.59705-1build1), libkrb5-3 (= 1.19.2-2), libkrb5support0 (= 1.19.2-2), liblz4-1 (= 1.9.3-2build2), liblzma5 (= 5.2.5-2ubuntu1), libmagic-mgc (= 1:5.41-3), libmagic1 (= 1:5.41-3), libmd0 (= 1.0.4-1build1), libmime-charset-perl (= 1.012.2-1), libmount-dev (= 2.37.2-4ubuntu3), libmount1 (= 2.37.2-4ubuntu3), libmpc3 (= 1.2.1-2build1), libmpdec3 (= 2.5.1-2build2), libmpfr6 (= 4.1.0-3build3), libncursesw6 (= 6.3-2), libnetpbm10 (= 2:10.0-15.4), libnettle8 (= 3.7.3-1build2), libnsl-dev (= 1.3.0-2build2), libnsl2 (= 1.3.0-2build2), libopenjp2-7 (= 2.4.0-6), libosp5 (= 1.5.2-13ubuntu3), libp11-kit0 (= 0.24.0-6build1), libpam-modules (= 1.4.0-11ubuntu2), libpam-modules-bin (= 1.4.0-11ubuntu2), libpam-runtime (= 1.4.0-11ubuntu2), libpam0g (= 1.4.0-11ubuntu2), libpaper-utils (= 1.1.28build2), libpaper1 (= 1.1.28build2), libpcre16-3 (= 2:8.39-13build5), libpcre2-16-0 (= 10.39-3build1), libpcre2-32-0 (= 10.39-3build1), libpcre2-8-0 (= 10.39-3build1), libpcre2-dev (= 10.39-3build1), libpcre2-posix3 (= 10.39-3build1), libpcre3 (= 2:8.39-13build5), libpcre3-dev (= 2:8.39-13build5), libpcre32-3 (= 2:8.39-13build5), libpcrecpp0v5 (= 2:8.39-13build5), libperl5.34 (= 5.34.0-3ubuntu1), libpipeline1 (= 1.5.5-1), libpixman-1-0 (= 0.40.0-1build4), libpng16-16 (= 1.6.37-3build5), libptexenc1 (= 2021.20210626.59705-1build1), libpython3-stdlib (= 3.10.4-0ubuntu2), libpython3.10-minimal (= 3.10.4-3), libpython3.10-stdlib (= 3.10.4-3), libreadline8 (= 8.1.2-1), libselinux1 (= 3.3-1build2), libselinux1-dev (= 3.3-1build2), libsepol-dev (= 3.3-1build1), libsepol2 (= 3.3-1build1), libsigsegv2 (= 2.13-1ubuntu3), libsm6 (= 2:1.2.3-1build2), libsmartcols1 (= 2.37.2-4ubuntu3), libsombok3 (= 2.4.0-2), libsqlite3-0 (= 3.37.2-2), libssl3 (= 3.0.2-0ubuntu1), libstdc++-12-dev (= 12-20220319-1ubuntu1), libstdc++6 (= 12-20220319-1ubuntu1), libsub-override-perl (= 0.09-2), libsynctex2 (= 2021.20210626.59705-1build1), libsystemd0 (= 249.11-0ubuntu3), libtasn1-6 (= 4.18.0-4build1), libteckit0 (= 2.5.11+ds1-1), libtexlua53 (= 2021.20210626.59705-1build1), libthai-data (= 0.1.29-1build1), libthai0 (= 0.1.29-1build1), libtiff5 (= 4.3.0-6), libtinfo6 (= 6.3-2), libtirpc-common (= 1.3.2-2build1), libtirpc-dev (= 1.3.2-2build1), libtirpc3 (= 1.3.2-2build1), libtool (= 2.4.6-15build2), libuchardet0 (= 0.0.7-1build2), libudev1 (= 249.11-0ubuntu3), libunicode-linebreak-perl (= 0.0.20190101-1build3), libunistring2 (= 1.0-1), libuuid1 (= 2.37.2-4ubuntu3), libwebp7 (= 1.2.2-2), libx11-6 (= 2:1.7.5-1), libx11-data (= 2:1.7.5-1), libxau6 (= 1:1.0.9-1build5), libxaw7 (= 2:1.0.14-1), libxcb-render0 (= 1.14-3ubuntu3), libxcb-shm0 (= 1.14-3ubuntu3), libxcb1 (= 1.14-3ubuntu3), libxdmcp6 (= 1:1.1.3-0ubuntu5), libxext6 (= 2:1.3.4-1build1), libxi6 (= 2:1.8-1build1), libxml2 (= 2.9.13+dfsg-1build1), libxmu6 (= 2:1.1.3-3), libxpm4 (= 1:3.5.12-1build2), libxrender1 (= 1:0.9.10-1build4), libxt6 (= 1:1.2.1-1), libzstd1 (= 1.4.8+dfsg-3build1), libzzip-0-13 (= 0.13.72+dfsg.1-1.1), linux-libc-dev (= 5.15.0-25.25), lmodern (= 2.004.5-6.1), login (= 1:4.8.1-2ubuntu2), lsb-base (= 11.1.0ubuntu4), lto-disabled-list (= 24), m4 (= 1.4.18-5ubuntu2), make (= 4.3-4.1build1), man-db (= 2.10.2-1), mawk (= 1.3.4.20200120-3), media-types (= 7.0.0), ncurses-base (= 6.3-2), ncurses-bin (= 6.3-2), netpbm (= 2:10.0-15.4), opensp (= 1.5.2-13ubuntu3), patch (= 2.7.6-7build2), perl (= 5.34.0-3ubuntu1), perl-base (= 5.34.0-3ubuntu1), perl-modules-5.34 (= 5.34.0-3ubuntu1), pkg-config (= 0.29.2-1ubuntu3), po-debconf (= 1.0.21+nmu1), poppler-data (= 0.4.11-1), python3 (= 3.10.4-0ubuntu2), python3-distutils (= 3.10.4-0ubuntu1), python3-lib2to3 (= 3.10.4-0ubuntu1), python3-minimal (= 3.10.4-0ubuntu2), python3-psutil (= 5.9.0-1build1), python3.10 (= 3.10.4-3), python3.10-minimal (= 3.10.4-3), readline-common (= 8.1.2-1), rpcsvc-proto (= 1.4.2-0ubuntu6), sed (= 4.8-1ubuntu2), sensible-utils (= 0.0.17), sgml-base (= 1.30), sgml-data (= 2.0.11+nmu1), sysvinit-utils (= 3.01-1ubuntu1), t1utils (= 1.41-4build2), tar (= 1.34+dfsg-1build3), tex-common (= 6.17), texlive-base (= 2021.20220204-1), texlive-binaries (= 2021.20210626.59705-1build1), texlive-extra-utils (= 2021.20220204-1), texlive-latex-base (= 2021.20220204-1), texlive-luatex (= 2021.20220204-1), texlive-plain-generic (= 2021.20220204-1), ucf (= 3.0043), util-linux (= 2.37.2-4ubuntu3), uuid-dev (= 2.37.2-4ubuntu3), x11-common (= 1:7.7+23ubuntu2), xdg-utils (= 1.1.3-4.1ubuntu1), xfonts-encodings (= 1:1.0.5-0ubuntu2), xfonts-utils (= 1:7.7+6build2), xml-core (= 0.18+nmu1), xz-utils (= 5.2.5-2ubuntu1), zlib1g (= 1:1.2.11.dfsg-2ubuntu9), zlib1g-dev (= 1:1.2.11.dfsg-2ubuntu9) Environment: DEB_BUILD_OPTIONS="noautodbgsym nocheck parallel=8" DEB_BUILD_PROFILES="noudeb" LANG="C.UTF-8" LC_ALL="C.UTF-8" SOURCE_DATE_EPOCH="1587225421" +------------------------------------------------------------------------------+ | Package contents | +------------------------------------------------------------------------------+ wise_2.4.1-23_riscv64.deb ------------------------- new Debian package, version 2.0. size 985560 bytes: control archive=1941 bytes. 1801 bytes, 34 lines control 1742 bytes, 29 lines md5sums Package: wise Version: 2.4.1-23 Architecture: riscv64 Maintainer: Ubuntu Developers Original-Maintainer: Debian Med Packaging Team Installed-Size: 6760 Depends: libc6 (>= 2.34), libglib2.0-0 (>= 2.12.0), wise-data (= 2.4.1-23) Suggests: wise-doc (= 2.4.1-23) Section: science Priority: optional Homepage: https://www.ebi.ac.uk/~birney/wise2/ Description: comparison of biopolymers, like DNA and protein sequences Wise2 is a package focused on comparisons of biopolymers, commonly DNA and protein sequences. There are many other packages which do this, probably the best known being BLAST package (from NCBI) and the Fasta package (from Bill Pearson). There are other packages, such as the HMMER package (Sean Eddy) or SAM package (UC Santa Cruz) focused on hidden Markov models (HMMs) of biopolymers. . Wise2's particular forte is the comparison of DNA sequence at the level of its protein translation. This comparison allows the simultaneous prediction of say gene structure with homology based alignment. . Wise2 also contains other algorithms, such as the venerable Smith-Waterman algorithm, or more modern ones such as Stephen Altschul's generalised gap penalties, or even experimental ones developed in house, such as dba. The development of these algorithms is due to the ease of developing such algorithms in the environment used by Wise2. . Wise2 has also been written with an eye for reuse and maintainability. Although it is a pure C package you can access its functionality directly in Perl. Parts of the package (or the entire package) can be used by other C or C++ programs without namespace clashes as all externally linked variables have the unique identifier Wise2 prepended. drwxr-xr-x root/root 0 2020-04-18 15:57 ./ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/bin/ -rwxr-xr-x root/root 219984 2020-04-18 15:57 ./usr/bin/dba -rwxr-xr-x root/root 146160 2020-04-18 15:57 ./usr/bin/dnal -rwxr-xr-x root/root 1279160 2020-04-18 15:57 ./usr/bin/estwise -rwxr-xr-x root/root 1283360 2020-04-18 15:57 ./usr/bin/estwisedb -rwxr-xr-x root/root 1283352 2020-04-18 15:57 ./usr/bin/genewise -rwxr-xr-x root/root 1287520 2020-04-18 15:57 ./usr/bin/genewisedb -rwxr-xr-x root/root 240416 2020-04-18 15:57 ./usr/bin/genomewise -rwxr-xr-x root/root 260960 2020-04-18 15:57 ./usr/bin/promoterwise -rwxr-xr-x root/root 215848 2020-04-18 15:57 ./usr/bin/psw -rwxr-xr-x root/root 220016 2020-04-18 15:57 ./usr/bin/pswdb -rwxr-xr-x root/root 314552 2020-04-18 15:57 ./usr/bin/scanwise -rwxr-xr-x root/root 130136 2020-04-18 15:57 ./usr/bin/scanwise_server drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/share/ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/share/doc/ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/share/doc/wise/ -rw-r--r-- root/root 1973 2007-07-01 20:46 ./usr/share/doc/wise/README -rw-r--r-- root/root 320 2020-04-18 15:57 ./usr/share/doc/wise/README.Debian -rw-r--r-- root/root 1725 2020-04-18 15:57 ./usr/share/doc/wise/changelog.Debian.gz -rw-r--r-- root/root 4297 2020-04-18 15:57 ./usr/share/doc/wise/copyright -rw-r--r-- root/root 312 2020-04-18 15:57 ./usr/share/doc/wise/run-unit-test drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/share/man/ drwxr-xr-x root/root 0 2020-04-18 15:57 ./usr/share/man/man1/ -rw-r--r-- root/root 846 2020-04-18 15:57 ./usr/share/man/man1/dba.1.gz -rw-r--r-- root/root 557 2020-04-18 15:57 ./usr/share/man/man1/dnal.1.gz -rw-r--r-- root/root 595 2020-04-18 15:57 ./usr/share/man/man1/estwise.1.gz -rw-r--r-- root/root 594 2020-04-18 15:57 ./usr/share/man/man1/estwisedb.1.gz -rw-r--r-- root/root 594 2020-04-18 15:57 ./usr/share/man/man1/genewise.1.gz -rw-r--r-- root/root 595 2020-04-18 15:57 ./usr/share/man/man1/genewisedb.1.gz -rw-r--r-- root/root 605 2020-04-18 15:57 ./usr/share/man/man1/genomewise.1.gz -rw-r--r-- root/root 592 2020-04-18 15:57 ./usr/share/man/man1/promoterwise.1.gz -rw-r--r-- root/root 685 2020-04-18 15:57 ./usr/share/man/man1/psw.1.gz -rw-r--r-- root/root 585 2020-04-18 15:57 ./usr/share/man/man1/pswdb.1.gz -rw-r--r-- root/root 601 2020-04-18 15:57 ./usr/share/man/man1/scanwise.1.gz -rw-r--r-- root/root 584 2020-04-18 15:57 ./usr/share/man/man1/scanwise_server.1.gz +------------------------------------------------------------------------------+ | Post Build | +------------------------------------------------------------------------------+ +------------------------------------------------------------------------------+ | Cleanup | +------------------------------------------------------------------------------+ Purging /<> Not removing build depends: as requested +------------------------------------------------------------------------------+ | Summary | +------------------------------------------------------------------------------+ Build Architecture: riscv64 Build Type: any Build-Space: 250048 Build-Time: 807 Distribution: jammy Host Architecture: riscv64 Install-Time: 820 Job: wise_2.4.1-23.dsc Machine Architecture: riscv64 Package: wise Package-Time: 1666 Source-Version: 2.4.1-23 Space: 250048 Status: successful Version: 2.4.1-23 -------------------------------------------------------------------------------- Finished at 2022-04-23T01:37:59Z Build needed 00:27:46, 250048k disk space Adding user buildd to group lxd RUN: /usr/share/launchpad-buildd/bin/in-target scan-for-processes --backend=chroot --series=jammy --arch=riscv64 PACKAGEBUILD-23475775 Scanning for processes to kill in build PACKAGEBUILD-23475775 RUN: /usr/share/launchpad-buildd/bin/in-target umount-chroot --backend=chroot --series=jammy --arch=riscv64 PACKAGEBUILD-23475775 Stopping target for build PACKAGEBUILD-23475775 RUN: /usr/share/launchpad-buildd/bin/in-target remove-build --backend=chroot --series=jammy --arch=riscv64 PACKAGEBUILD-23475775 Removing build PACKAGEBUILD-23475775